CX3CL1 anticorps

N° du produit ABIN635921

Détail du produit anti-CX3CL1 anticorps

Antigène: CX3CL1 (Chemokine (C-X3-C Motif) Ligand 1 (CX3CL1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CX3CL1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ABCD3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKYGLNELKLCFRVRLTKYLYEEYLQAFTYYKMGNLDNRIANPDQLLTQD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ABCD3 Blocking Peptide, catalog no. 33R-5113, is also available for use as a blocking control in assays to test for specificity of this ABCD3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCD3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CX3CL1

Antigène: CX3CL1 (Chemokine (C-X3-C Motif) Ligand 1 (CX3CL1))

Autre désignation: ABCD3 (CX3CL1 Produits)

Synonymes: anticorps ABCD3, anticorps CX3CL1, anticorps DKFZp459K117, anticorps Cx3c, anticorps Scyd1, anticorps ABCD-3, anticorps C3Xkine, anticorps CXC3, anticorps CXC3C, anticorps NTN, anticorps NTT, anticorps SCYD1, anticorps fractalkine, anticorps neurotactin, anticorps AB030188, anticorps AI848747, anticorps CX3C, anticorps Cxc3, anticorps D8Bwg0439e, anticorps ATP binding cassette subfamily D member 3, anticorps C-X3-C motif chemokine ligand 1, anticorps chemokine (C-X3-C motif) ligand 1, anticorps ABCD3, anticorps CX3CL1, anticorps Cx3cl1, anticorps Abcd3

Sujet: The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes.

Poids moléculaire: 75 kDa (MW of target protein)

Pathways: Synaptic Membrane