TMX2 anticorps (Middle Region)

N° du produit ABIN635980

Détail du produit anti-TMX2 anticorps

Antigène: TMX2 (Thioredoxin-Related Transmembrane Protein 2 (TMX2))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMX2 est non-conjugé

Application: Western Blotting (WB)

Specificité: TXNDC14 antibody was raised against the middle region of TXNDC14

Purification: Affinity purified

Immunogène: TXNDC14 antibody was raised using the middle region of TXNDC14 corresponding to a region with amino acids IRMGLLYITLCIVFLMTCKPPLYMGPEYIKYFNDKTIDEELERDKRVTWI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TXNDC14 Blocking Peptide, catalog no. 33R-4138, is also available for use as a blocking control in assays to test for specificity of this TXNDC14 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TXNDC14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMX2

Antigène: TMX2 (Thioredoxin-Related Transmembrane Protein 2 (TMX2))

Autre désignation: TXNDC14 (TMX2 Produits)

Synonymes: anticorps PDIA12, anticorps PIG26, anticorps TXNDC14, anticorps 2310042M24Rik, anticorps AA589631, anticorps Txndc14, anticorps tmx2, anticorps txndc14, anticorps wu:fb73h06, anticorps zgc:86830, anticorps pig26, anticorps cgi-31, anticorps MGC79568, anticorps DKFZp469G2332, anticorps im:7138651, anticorps zgc:172264, anticorps thioredoxin related transmembrane protein 2, anticorps thioredoxin-related transmembrane protein 2, anticorps thioredoxin-related transmembrane protein 2b, anticorps thioredoxin domain containing 14, anticorps thioredoxin related transmembrane protein 2 S homeolog, anticorps thioredoxin-related transmembrane protein 2a, anticorps TMX2, anticorps Tmx2, anticorps tmx2b, anticorps tmx2, anticorps CpipJ_CPIJ000873, anticorps tmx2.S, anticorps tmx2a

Sujet: The function of TXNDC14 has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 34 kDa (MW of target protein)