C1GALT1 anticorps (Middle Region)

N° du produit ABIN636002

Détail du produit anti-C1GALT1 anticorps

Antigène: C1GALT1 (Core 1 Synthase, Glycoprotein-N-Acetylgalactosamine 3-beta-Galactosyltransferase, 1 (C1GALT1))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C1GALT1 est non-conjugé

Application: Western Blotting (WB)

Specificité: C1 GALT1 antibody was raised against the middle region of C1 ALT1

Purification: Affinity purified

Immunogène: C1 GALT1 antibody was raised using the middle region of C1 ALT1 corresponding to a region with amino acids NVEAGDSRDTIGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C1GALT1 Blocking Peptide, catalog no. 33R-6911, is also available for use as a blocking control in assays to test for specificity of this C1GALT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 ALT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C1GALT1

Antigène: C1GALT1 (Core 1 Synthase, Glycoprotein-N-Acetylgalactosamine 3-beta-Galactosyltransferase, 1 (C1GALT1))

Autre désignation: C1GALT1 (C1GALT1 Produits)

Synonymes: anticorps C1GALT, anticorps T-synthase, anticorps 2210410E06Rik, anticorps AV284120, anticorps c1galt1, anticorps fa98f05, anticorps zgc:66485, anticorps wu:fa98f05, anticorps C1GALT1, anticorps C1GalT1-A, anticorps Core 1 beta3-Gal-T1-A, anticorps wu:fi11c09, anticorps zgc:153355, anticorps core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1, anticorps glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 L homeolog, anticorps core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1, anticorps core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1b, anticorps core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1a, anticorps C1GALT1, anticorps LOC100496837.L, anticorps C1galt1, anticorps c1galt1b, anticorps c1galt1a

Sujet: The common core 1 O-glycan structure Gal-beta-1-3GalNAc-R is a precursor for many extended mucin-type O-glycan structures in animal cell surface and secreted glycoproteins.

Poids moléculaire: 42 kDa (MW of target protein)