B3GALT6 anticorps (N-Term)
-
- Antigène Voir toutes B3GALT6 Anticorps
- B3GALT6 (UDP-Gal:betaGal beta 1,3-Galactosyltransferase Polypeptide 6 (B3GALT6))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp B3GALT6 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- B3 GALT6 antibody was raised against the N terminal of B3 ALT6
- Purification
- Affinity purified
- Immunogène
- B3 GALT6 antibody was raised using the N terminal of B3 ALT6 corresponding to a region with amino acids EREQARHGDLLLLPALRDAYENLTAKVLAMLAWLDEHVAFEFVLKADDDS
- Top Product
- Discover our top product B3GALT6 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
B3GALT6 Blocking Peptide, catalog no. 33R-2691, is also available for use as a blocking control in assays to test for specificity of this B3GALT6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALT6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- B3GALT6 (UDP-Gal:betaGal beta 1,3-Galactosyltransferase Polypeptide 6 (B3GALT6))
- Autre désignation
- B3GALT6 (B3GALT6 Produits)
- Synonymes
- anticorps B3GALT6, anticorps MGC69183, anticorps Dyak\\GE22868, anticorps GE22868, anticorps beta3galt6, anticorps dyak_GLEANR_663, anticorps Dere\\GG10628, anticorps GG10628, anticorps dere_GLEANR_10535, anticorps Dper\\GL21178, anticorps GL21178, anticorps dper_GLEANR_3106, anticorps Dsec\\GM20673, anticorps GM20673, anticorps dsec_GLEANR_3487, anticorps Dpse\\GA28758, anticorps GA28758, anticorps dpse_GLEANR_8882, anticorps EDSP2, anticorps SEMDJL1, anticorps beta3GalT6, anticorps BB129894, anticorps GalTII, anticorps beta-1,3-galactosyltransferase 6, anticorps Beta-1,3-galactosyltransferase 6, anticorps UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6, anticorps UDP-Gal:betaGal beta 1,3-galactosyltransferase, polypeptide 6, anticorps B3GALT6, anticorps b3galt6, anticorps CpipJ_CPIJ010407, anticorps Dyak\beta3galt6, anticorps Dere\beta3galt6, anticorps Dper\beta3galt6, anticorps Dsec\beta3galt6, anticorps Dpse\beta3galt6, anticorps LOC100285906, anticorps B3galt6
- Sujet
- B3GALT6 (Beta-1,3-galactosyltransferase) transfers galactose from UDP-galactose to substrates with a terminal beta-linked galactose residue. It has a preference for galactose-beta-1,4-xylose that is found in the linker region of glycosaminoglycans, such as heparan sulfate and chondroitin sulfate. It has no activity towards substrates with terminal glucosamine or galactosamine residues.
- Poids moléculaire
- 37 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-