RDH10 anticorps
-
- Antigène Voir toutes RDH10 Anticorps
- RDH10 (Retinol Dehydrogenase 10 (All-Trans) (RDH10))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RDH10 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- RDH10 antibody was raised using a synthetic peptide corresponding to a region with amino acids QSNEETAGMVRHIYRDLEAADAAALQAGNGEEEILPHCNLQVFTYTCDVG
- Top Product
- Discover our top product RDH10 Anticorps primaire
-
anti-Retinol Dehydrogenase 10 (All-Trans) (RDH10) (AA 106-135) antibody
RDH10 Reactivité: Humain WB, FACS, IHC (p) Hôte: Lapin Polyclonal RB25251 unconjugated
anti-Retinol Dehydrogenase 10 (All-Trans) (RDH10) (Internal Region) antibodyRDH10 Reactivité: Humain, Souris, Rat WB, IHC, ICC, IF Hôte: Lapin Polyclonal unconjugated
anti-Retinol Dehydrogenase 10 (All-Trans) (RDH10) (AA 71-120) antibodyRDH10 Reactivité: Humain, Souris, Rat, Lapin, Boeuf (Vache), Chien, Cheval, Roussette (Chauve-souris), Singe, Porc WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Retinol Dehydrogenase 10 (All-Trans) (RDH10) (AA 242-291) antibodyRDH10 Reactivité: Humain, Souris, Rat, Lapin, Boeuf (Vache), Chien, Cheval, Cobaye, Poisson zèbre (Danio rerio), Roussette (Chauve-souris), Singe, Porc, Xenopus laevis WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RDH10 Blocking Peptide, catalog no. 33R-7732, is also available for use as a blocking control in assays to test for specificity of this RDH10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RDH10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RDH10 (Retinol Dehydrogenase 10 (All-Trans) (RDH10))
- Autre désignation
- RDH10 (RDH10 Produits)
- Synonymes
- anticorps cb804, anticorps rdh10, anticorps SDR16C4, anticorps 3110069K09Rik, anticorps 4921506A21Rik, anticorps AI875664, anticorps AW549993, anticorps D1Ertd762e, anticorps m366Asp, anticorps retinol dehydrogenase 10b, anticorps retinol dehydrogenase 10, anticorps retinol dehydrogenase 10 (all-trans), anticorps rdh10b, anticorps MCYG_00691, anticorps RDH10, anticorps Rdh10
- Sujet
- RDH10 is a retinol dehydrogenase with a clear preference for NADP. RDH10 converts all-trans-retinol to all-trans-retinal. RDH10 has no detectable activity towards 11-cis-retinol, 9-cis-retinol and 13-cis-retinol.RDH10 generates all-trans retinal from all-trans retinol and may plan an important role in the photic visual cycle.
- Poids moléculaire
- 38 kDa (MW of target protein)
-
