RDH10 anticorps

N° du produit ABIN636035

L’anticorps anti-RDH10 Polyclonal Lapin est utilisé pour la détection de RDH10 dans des échantillons de Humain, Rat et Souris. Il a été validé pour WB.

Aperçu rapide pour RDH10 anticorps (ABIN636035)

Antigène: RDH10 (Retinol Dehydrogenase 10 (All-Trans) (RDH10))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RDH10 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RDH10 anticorps

Purification: Affinity purified

Immunogène: RDH10 antibody was raised using a synthetic peptide corresponding to a region with amino acids QSNEETAGMVRHIYRDLEAADAAALQAGNGEEEILPHCNLQVFTYTCDVG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RDH10 Blocking Peptide, (ABIN5615818), is also available for use as a blocking control in assays to test for specificity of this RDH10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RDH10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RDH10

Antigène: RDH10 (Retinol Dehydrogenase 10 (All-Trans) (RDH10))

Autre désignation: RDH10

Sujet: RDH10 is a retinol dehydrogenase with a clear preference for NADP. RDH10 converts all-trans-retinol to all-trans-retinal. RDH10 has no detectable activity towards 11-cis-retinol, 9-cis-retinol and 13-cis-retinol.RDH10 generates all-trans retinal from all-trans retinol and may plan an important role in the photic visual cycle.

Poids moléculaire: 38 kDa (MW of target protein)