FZD4 anticorps

N° du produit ABIN636047

Détail du produit anti-FZD4 anticorps

Antigène: FZD4 (Frizzled Family Receptor 4 (FZD4))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FZD4 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogène: FZD4 antibody was raised using a synthetic peptide corresponding to a region with amino acids GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FZD4 Blocking Peptide, catalog no. 33R-3346, is also available for use as a blocking control in assays to test for specificity of this FZD4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FZD4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FZD4

Antigène: FZD4 (Frizzled Family Receptor 4 (FZD4))

Autre désignation: FZD4 (FZD4 Produits)

Synonymes: anticorps CG4626, anticorps DFz4, anticorps Dfz4, anticorps Dm Fz4, anticorps Dmel\\CG4626, anticorps Fz4, anticorps anon-WO0170980.10, anticorps anon-WO0170980.11, anticorps fz1, anticorps zg01, anticorps CD344, anticorps EVR1, anticorps FEVR, anticorps FZD4S, anticorps Fz-4, anticorps FzE4, anticorps GPCR, anticorps hFz4, anticorps frizzled4, anticorps fz4, anticorps FZ-4, anticorps frizzled 4, anticorps frizzled class receptor 4, anticorps frizzled-4, anticorps frizzled class receptor 4 S homeolog, anticorps fz4, anticorps fzd4, anticorps Tsp_10376, anticorps FZD4, anticorps Fzd4, anticorps fzd4.S

Sujet: FZD4 is a member of the frizzled family. Members of this family are seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence.

Poids moléculaire: 60 kDa (MW of target protein)

Pathways: Signalisation WNT, Hormone Transport, Sensory Perception of Sound