TMPRSS12 anticorps (Middle Region)

N° du produit ABIN636063

Détail du produit anti-TMPRSS12 anticorps

Antigène: TMPRSS12 (Transmembrane (C-terminal) Protease, serine 12 (TMPRSS12))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMPRSS12 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMPRSS12 antibody was raised against the middle region of TMPRSS12

Purification: Affinity purified

Immunogène: TMPRSS12 antibody was raised using the middle region of TMPRSS12 corresponding to a region with amino acids KEEGNATNILQDAEVHYISREMCNSERSYGGIIPNTSFCAGDEDGAFDTC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMPRSS12 Blocking Peptide, catalog no. 33R-4324, is also available for use as a blocking control in assays to test for specificity of this TMPRSS12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMPRSS12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMPRSS12

Antigène: TMPRSS12 (Transmembrane (C-terminal) Protease, serine 12 (TMPRSS12))

Autre désignation: TMPRSS12 (TMPRSS12 Produits)

Synonymes: anticorps 4930478A21Rik, anticorps transmembrane protease, serine 12, anticorps transmembrane (C-terminal) protease, serine 12, anticorps TMPRSS12, anticorps tmprss12, anticorps Tmprss12

Sujet: TMPRSS12 belongs to the ARG-specific ADP-ribosyltransferase family. Proteins in this family regulate the function of target proteins by attaching ADP-ribose to specific amino acid residues in their target proteins. The mouse homolog lacks a glycosylphosphatidylinositol-anchor signal sequence and is predicted to be a secretory enzyme.

Poids moléculaire: 38 kDa (MW of target protein)