HTRA4 anticorps (Middle Region)

N° du produit ABIN636082

Détail du produit anti-HTRA4 anticorps

Antigène: HTRA4 (HtrA Serine Peptidase 4 (HTRA4))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HTRA4 est non-conjugé

Application: Western Blotting (WB)

Specificité: HTRA4 antibody was raised against the middle region of HTRA4

Purification: Affinity purified

Immunogène: HTRA4 antibody was raised using the middle region of HTRA4 corresponding to a region with amino acids LKMHYPDFPDVSSGVYVCKVVEGTAAQSSGLRDHDVIVNINGKPITTTTD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HTRA4 Blocking Peptide, catalog no. 33R-5091, is also available for use as a blocking control in assays to test for specificity of this HTRA4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HTRA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HTRA4

Antigène: HTRA4 (HtrA Serine Peptidase 4 (HTRA4))

Autre désignation: HTRA4 (HTRA4 Produits)

Synonymes: anticorps B430206E18Rik, anticorps RGD1306242, anticorps HtrA serine peptidase 4, anticorps HTRA4, anticorps Htra4

Sujet: HTRA4 is a member of the HtrA family of proteases. The protein contains a putative signal peptide, an insulin growth factor binding domain, a Kazal protease inhibitor domain, a conserved trypsin domain and a PDZ domain. Based on studies on other related family members, this enzyme may function as a secreted oligomeric chaperone protease to degrade misfolded secretory proteins. Other human HtrA proteins have been implicated in arthritis, tumor suppression, unfolded stress response, apoptosis, and aging.

Poids moléculaire: 51 kDa (MW of target protein)