SLC22A6 anticorps

N° du produit ABIN636098

Détail du produit anti-SLC22A6 anticorps

Antigène: SLC22A6 (Solute Carrier Family 22 Member 6 (SLC22A6))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC22A6 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SLC22 A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids ETLGQPLPDTVQDLESRWAPTQKEAGIYPRKGKQTRQQQEHQKYMVPLQA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC22A6 Blocking Peptide, catalog no. 33R-2764, is also available for use as a blocking control in assays to test for specificity of this SLC22A6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC22A6

Antigène: SLC22A6 (Solute Carrier Family 22 Member 6 (SLC22A6))

Autre désignation: SLC22A6 (SLC22A6 Produits)

Synonymes: anticorps HOAT1, anticorps OAT1, anticorps PAHT, anticorps ROAT1, anticorps NKT, anticorps Oat1, anticorps Orctl1, anticorps mOat1, anticorps slc22a6, anticorps zgc:77073, anticorps SLC22A6, anticorps Paht, anticorps Roat1, anticorps nkt, anticorps oat1, anticorps oat1-B, anticorps paht, anticorps roat1, anticorps slc22a6-B, anticorps Slc22a6, anticorps solute carrier family 22 member 6, anticorps solute carrier family 22 (organic anion transporter), member 6, anticorps solute carrier family 22 (organic anion transporter), member 6, like, anticorps Solute carrier family 22 member 6, anticorps solute carrier family 22 (organic anion transporter), member 6 S homeolog, anticorps SLC22A6, anticorps Slc22a6, anticorps slc22a6l, anticorps s22a6, anticorps slc22a6.S

Sujet: SLC22A6 is involved in the sodium-dependent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and may be localized to the basolateral membrane.

Poids moléculaire: 62 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport