LRFN5 anticorps (Middle Region)

N° du produit ABIN636112

Détail du produit anti-LRFN5 anticorps

Antigène: LRFN5 (Leucine Rich Repeat and Fibronectin Type III Domain Containing 5 (LRFN5))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LRFN5 est non-conjugé

Application: Western Blotting (WB)

Specificité: LRFN5 antibody was raised against the middle region of LRFN5

Purification: Affinity purified

Immunogène: LRFN5 antibody was raised using the middle region of LRFN5 corresponding to a region with amino acids PLITRHTHEMRVLEGQRATLRCKARGDPEPAIHWISPEGKLISNATRSLV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LRFN5 Blocking Peptide, catalog no. 33R-7195, is also available for use as a blocking control in assays to test for specificity of this LRFN5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRFN5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LRFN5

Antigène: LRFN5 (Leucine Rich Repeat and Fibronectin Type III Domain Containing 5 (LRFN5))

Autre désignation: LRFN5 (LRFN5 Produits)

Synonymes: anticorps C14orf146, anticorps FIGLER8, anticorps SALM5, anticorps AI427653, anticorps AI604817, anticorps C130061B21, anticorps mKIAA4208, anticorps leucine rich repeat and fibronectin type III domain containing 5, anticorps LRFN5, anticorps Lrfn5

Sujet: The specific function of LRFN5 is not yet known.

Poids moléculaire: 79 kDa (MW of target protein)