MADCAM1 anticorps

N° du produit ABIN6719343

Détail du produit anti-MADCAM1 anticorps

Antigène: MADCAM1 (Mucosal Vascular Addressin Cell Adhesion Molecule 1 (MADCAM1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MADCAM1 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for MAdCAM1 detection. Tested with WB in Human.

Séquence: QELEGAQALG PEVQEEEEEP QGDEDVLFRV TERWRL

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for MAdCAM1 detection. Tested with WB in Human.

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence of human MAdCAM1 (QELEGAQALGPEVQEEEEEPQGDEDVLFRVTERWRL).

Isotype: IgG

Information d'application

Indications d'application:

Application details: Western blot|0.1-0.5 μg/mL

Commentaires:

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur MADCAM1

Antigène: MADCAM1 (Mucosal Vascular Addressin Cell Adhesion Molecule 1 (MADCAM1))

Autre désignation: MADCAM1 (MADCAM1 Produits)

Synonymes: anticorps MACAM1, anticorps AV211525, anticorps mucosal vascular addressin cell adhesion molecule 1, anticorps MADCAM1, anticorps Madcam1

Sujet:

Synonyms: Mucosal addressin cell adhesion molecule 1, MAdCAM-1, hMAdCAM-1, MADCAM1

Background: MADCAM1 (Mucosal Vascular Addressin Cell Adhesion Molecule 1), also known as MACAM1, is a protein that in humans is encoded by the MADCAM1 gene. By PCR-based analysis of somatic cell hybrids, this gene is mapped to chromosome 19. The protein encoded by this gene is an endothelil cell adhesion molecule that interacts preferentially with the leukocyte beta7 integrin LPAM-1 (alpha4 / beta7), L-selectin, and VLA-4 (alpha4 / beta1) on myeloid cells to direct leukocytes into mucosal and inflamed tissues. It is a member of the immunoglobulin superfamily and is similar to ICAM-1 and VCAM-1.

ID gène: 8174

UniProt: Q13477