KCNA2 anticorps (C-Term, Intracellular)

N° du produit ABIN7043517

Détail du produit anti-KCNA2 anticorps

Antigène: KCNA2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 2 (KCNA2))

Épitope: AA 417-499, C-Term, Intracellular

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNA2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Immunocytochemistry (ICC)

Attributs du produit: Anti-Kv1.2 (KCNA2) Antibody is directed against an epitope of rat KV1.2. Anti-KV1.2 (KCNA2) Antibody (ABIN7043517, ABIN7044912 and ABIN7044913)) can be used in western blot, immunohistochemistry, and immunocytochemistry applications. It has been designed to recognize KV1.2 from human, rat, and mouse samples.

Purification: The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

Immunogène:

Immunogen: GST fusion protein

Immunogen Sequence: GST fusion protein with the sequence YHRETEGEEQAQYLQVTSCPKIPSSPDLKK SRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV, corresponding to amino acid residues 417-499 of rat KV1.2

Isotype: IgG

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: 25 μL, 50 μL or 0.2 mL double distilled water (DDW), depending on the sample size.

Concentration: 0.8 mg/mL

Buffer: Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1 % BSA, 5 % sucrose, 0.025 % Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: RT,4 °C,-20 °C

Stockage commentaire:

Storage before reconstitution: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.

Storage after reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).

Détails sur KCNA2

Antigène: KCNA2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 2 (KCNA2))

Autre désignation: KV1.2 (KCNA2) (KCNA2 Produits)

Synonymes: anticorps KCNA2, anticorps kcna2, anticorps HBK5, anticorps HK4, anticorps HUKIV, anticorps KV1.2, anticorps MK2, anticorps NGK1, anticorps RBK2, anticorps Akr6a4, anticorps ENSMUSG00000074335, anticorps Gm10672, anticorps Kca1-2, anticorps Kv1.2, anticorps Mk-2, anticorps BK2, anticorps XSha2, anticorps k(v)1.2, anticorps kcna2-a, anticorps kv1.2, anticorps potassium voltage-gated channel subfamily A member 2, anticorps potassium channel, voltage gated shaker related subfamily A, member 1, anticorps potassium voltage-gated channel, shaker-related subfamily, member 2, anticorps potassium channel, voltage gated shaker related subfamily A, member 2 S homeolog, anticorps KCNA2, anticorps kcna1, anticorps Kcna2, anticorps LOC100537815, anticorps kcna2.S

Sujet: Alternative names: KV1.2 (KCNA2), Potassium voltage-gated channel subfamily A member 2, RBK2

ID gène: 25468

NCBI Accession: NM_004974

UniProt: P63142