KCNA2 anticorps (C-Term, Intracellular)
-
- Antigène Voir toutes KCNA2 Anticorps
- KCNA2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 2 (KCNA2))
-
Épitope
- AA 417-499, C-Term, Intracellular
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KCNA2 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Immunocytochemistry (ICC)
- Attributs du produit
- Anti-Kv1.2 (KCNA2) Antibody is directed against an epitope of rat KV1.2. Anti-KV1.2 (KCNA2) Antibody (ABIN7043517, ABIN7044912 and ABIN7044913)) can be used in western blot, immunohistochemistry, and immunocytochemistry applications. It has been designed to recognize KV1.2 from human, rat, and mouse samples.
- Purification
- The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
- Immunogène
-
Immunogen: GST fusion protein
Immunogen Sequence: GST fusion protein with the sequence YHRETEGEEQAQYLQVTSCPKIPSSPDLKK SRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV, corresponding to amino acid residues 417-499 of rat KV1.2
- Isotype
- IgG
- Top Product
- Discover our top product KCNA2 Anticorps primaire
-
-
- Indications d'application
- Optimal working dilution should be determined by the investigator.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- 25 μL, 50 μL or 0.2 mL double distilled water (DDW), depending on the sample size.
- Concentration
- 0.8 mg/mL
- Buffer
- Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1 % BSA, 5 % sucrose, 0.025 % Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- RT,4 °C,-20 °C
- Stockage commentaire
-
Storage before reconstitution: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.
Storage after reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
-
- Antigène
- KCNA2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 2 (KCNA2))
- Autre désignation
- KV1.2 (KCNA2) (KCNA2 Produits)
- Synonymes
- anticorps KCNA2, anticorps kcna2, anticorps HBK5, anticorps HK4, anticorps HUKIV, anticorps KV1.2, anticorps MK2, anticorps NGK1, anticorps RBK2, anticorps Akr6a4, anticorps ENSMUSG00000074335, anticorps Gm10672, anticorps Kca1-2, anticorps Kv1.2, anticorps Mk-2, anticorps BK2, anticorps XSha2, anticorps k(v)1.2, anticorps kcna2-a, anticorps kv1.2, anticorps potassium voltage-gated channel subfamily A member 2, anticorps potassium channel, voltage gated shaker related subfamily A, member 1, anticorps potassium voltage-gated channel, shaker-related subfamily, member 2, anticorps potassium channel, voltage gated shaker related subfamily A, member 2 S homeolog, anticorps KCNA2, anticorps kcna1, anticorps Kcna2, anticorps LOC100537815, anticorps kcna2.S
- Sujet
- Alternative names: KV1.2 (KCNA2), Potassium voltage-gated channel subfamily A member 2, RBK2
- ID gène
- 25468
- NCBI Accession
- NM_004974
- UniProt
- P63142
-