KCNH2 anticorps (C-Term, Intracellular)
-
- Antigène Voir toutes KCNH2 Anticorps
- KCNH2 (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 2 (KCNH2))
-
Épitope
- AA 1106-1159, C-Term, Intracellular
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KCNH2 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Immunocytochemistry (ICC), Immunoprecipitation (IP)
- Réactivité croisée (Details)
- The antibody recognizes the HERG1b splice variant but not splice variants HERG1-3 and HERG-4
- Attributs du produit
- Anti-KCNH2 (HERG) Antibody is directed against an intracellular epitope of the human KV11.1 channel. Anti-KCNH2 (HERG) Antibody (ABIN7043544, ABIN7044976 and ABIN7044977)) can be used in western blot, immunoprecipitation, immunohistochemical and immunocytochemical applications. It has been designed to recognize KV11.1 from human, rat, and mouse samples.
- Purification
- The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
- Immunogène
-
Immunogen: GST fusion protein
Immunogen Sequence: GST fusion protein with the sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS, corresponding to amino acid residues 1106-1159 of human KV11.1 (HERG)
- Isotype
- IgG
- Top Product
- Discover our top product KCNH2 Anticorps primaire
-
-
- Indications d'application
- Optimal working dilution should be determined by the investigator.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- 25 μL, 50 μL or 0.2 mL double distilled water (DDW), depending on the sample size.
- Concentration
- 0.6 mg/mL
- Buffer
- Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1 % BSA, 0.05 % Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- RT,4 °C,-20 °C
- Stockage commentaire
-
Storage before reconstitution: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.
Storage after reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
-
- Antigène
- KCNH2 (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 2 (KCNH2))
- Autre désignation
- KCNH2 (HERG) (KCNH2 Produits)
- Synonymes
- anticorps ERG1, anticorps HERG, anticorps HERG1, anticorps Kv11.1, anticorps LQT2, anticorps SQT1, anticorps erg, anticorps KCNH2, anticorps ERG, anticorps gp-erg, anticorps cerg, anticorps derg, anticorps erg1, anticorps AI326795, anticorps LQT, anticorps Lqt2, anticorps M-erg, anticorps Merg1, anticorps merg1a, anticorps merg1b, anticorps potassium voltage-gated channel subfamily H member 2, anticorps potassium voltage-gated channel, subfamily H (eag-related), member 6a, anticorps potassium voltage-gated channel, subfamily H (eag-related), member 2, anticorps potassium voltage-gated channel subfamily H member 6, anticorps KCNH2, anticorps kcnh6a, anticorps Kcnh2, anticorps KCNH6
- Sujet
- Alternative names: KCNH2 (HERG), KV11.1, Potassium voltage-gated channel subfamily H member 2, Ether-a-go-go-related channel 1
- ID gène
- 3757
- NCBI Accession
- NM_000238
- UniProt
- Q12809
-