YY1 anticorps

N° du produit ABIN7882716

Cet anticorps Souris Monoclonal détecte spécifiquement YY1 dans WB, IF, IHC (p) et FACS. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour YY1 anticorps (ABIN7882716)

Antigène: YY1 (YY1 Transcription Factor (YY1))

Reactivité: Humain, Souris, Rat

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp YY1 est non-conjugé

Application: Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Clone: 3F3E7

Détail du produit anti-YY1 anticorps

Fonction: YY1 Antibody

Séquence: EQKQVQIKTL EGEFSVTMWS SDEKKDIDHE TVVEEQ

Purification: Antigen affinity purified

Immunogène: Amino acids EQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQ were used as the immunogen for the YY1 antibody.

Isotype: IgG1

Information d'application

Indications d'application: Optimal dilution of the YY1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the YY1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur YY1

Antigène: YY1 (YY1 Transcription Factor (YY1))

Autre désignation: YY1

Sujet: YY1 (Yin Yang 1) is a transcriptional repressor protein in humans that is encoded by the YY1 gene. YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters. YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1.

UniProt: P25490