YY1 anticorps

N° du produit ABIN7882717

L’anticorps anti-YY1 Monoclonal Souris est utilisé pour la détection de YY1 dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB, IHC (p) et FACS.

Aperçu rapide pour YY1 anticorps (ABIN7882717)

Antigène: YY1 (YY1 Transcription Factor (YY1))

Reactivité: Humain, Souris, Rat

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp YY1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Clone: 2C10F9

Détail du produit anti-YY1 anticorps

Fonction: YY1 Antibody / Yin and Yang 1

Séquence: EQKQVQIKTL EGEFSVTMWS SDEKKDIDHE TVVEEQ

Purification: Antigen affinity purified

Immunogène: Amino acids EQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQ were used as the immunogen for the YY1 antibody.

Isotype: IgG2a

Information d'application

Indications d'application: Optimal dilution of the YY1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the YY1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur YY1

Antigène: YY1 (YY1 Transcription Factor (YY1))

Autre désignation: YY1

Sujet: YY1 (Yin Yang 1) is a transcriptional repressor protein in humans that is encoded by the YY1 gene. YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters. YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1.

UniProt: P25490