TNFAIP3 anticorps

N° du produit ABIN8115018

Cet anticorps anti-TNFAIP3 Polyclonal Lapin (ABIN8115018) détecte spécifiquement TNFAIP3 dans IHC. L’anticorps est réactif avec des échantillons de Humain, Souris, Rat, Chien, Lapin, Boeuf (Vache) et Cheval.

Aperçu rapide pour TNFAIP3 anticorps (ABIN8115018)

Antigène: TNFAIP3 (Tumor Necrosis Factor, alpha-Induced Protein 3 (TNFAIP3))

Reactivité: Humain, Souris, Rat, Chien, Lapin, Boeuf (Vache), Cheval

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TNFAIP3 est non-conjugé

Application: Immunohistochemistry (IHC)

Détail du produit anti-TNFAIP3 anticorps

Fonction: TNFAIP3 Antibody

Séquence: LGSTMFEGYC QKCFIEAQNQ RFHEAKRTEE QLRSSQRRDV PRTTQSTSRP

Homologie: Cow: 77%, Dog: 77%, Horse: 85%, Human: 100%, Mouse: 83%, Rabbit: 100%, Rat: 83%

Purification: Affinity Purified

Immunogène: The immunogen is a synthetic peptide directed towards the following sequence LGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQRRDVPRTTQSTSRP

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP61326-100UG

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: prevent freeze-thaw cycles

Stock: 4 °C,-20 °C

Stockage commentaire: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Détails sur TNFAIP3

Antigène: TNFAIP3 (Tumor Necrosis Factor, alpha-Induced Protein 3 (TNFAIP3))

Autre désignation: TNFAIP3

Sujet:

Background Information: This gene was identified as a gene whose expression is rapidly induced by the tumor necrosis factor (TNF). The protein encoded by this gene is a zinc finger protein and ubiqitin-editing enzyme, and has been shown to inhibit NF-kappa B activation as well as TNF-mediated apoptosis. The encoded protein, which has both ubiquitin ligase and deubiquitinase activities, is involved in the cytokine-mediated immune and inflammatory responses. Several transcript variants encoding the same protein have been found for this gene.

Gene Name: tumor necrosis factor, alpha-induced protein 3

Alternative Symbols: A20, AISBL, OTUD7C, TNFA1P2

Protein Name: Tumor necrosis factor alpha-induced protein 3

Poids moléculaire: 90 kDa

ID gène: 7128

NCBI Accession: NP_006281

UniProt: P21580

Pathways: Signalisation TLR, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Production of Molecular Mediator of Immune Response