anti-Humain YBX2 anticorps pour Immunofluorescence

Recommended YBX2 Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Y Box Binding Protein 2 (YBX2) Anticorps
  • YBX2
  • dbpc
  • msy2
  • csda3
  • frgy2
  • contrin
  • CONTRIN
  • CSDA3
  • DBPC
  • MSY2
  • RGD1305068
  • Msy2
  • Y-box binding protein 2
  • Y box binding protein 2
  • Y box protein 2
  • YBX2
  • ybx2
  • Ybx2
Reactivité
Humain
74
25
14
4
4
3
2
2
1
Hôte
Lapin
73
1
Clonalité
Polyclonal
Conjugué
Cet anticorp YBX2 est non-conjugé
4
4
4
4
4
4
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
72
50
38
16
12
5
4
4
1
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4335907
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
11.391936 ABIN4335905 ELISA ICC IF IHC IHC (p) WB Rabbit C-Term Connectez-vous pour afficher Polyclonal 0
11.391936 ABIN4335906 ICC IF IHC IHC (p) WB Rabbit IgG Center Connectez-vous pour afficher Polyclonal 0
11.391936 ABIN949283 IF IHC (p) WB Mouse AA 1-364, full length Connectez-vous pour afficher Polyclonal 0
1 ABIN1804617 ICC IF IHC IHC (p) WB Rabbit IgG Internal Region Connectez-vous pour afficher Polyclonal 0
1 ABIN408269 ICC IF IHC WB Rabbit Connectez-vous pour afficher Polyclonal 0
1 ABIN3185700 ELISA IF IHC WB Rabbit IgG C-Term Connectez-vous pour afficher Polyclonal 0
1 ABIN6286078 ELISA IF IHC (p) WB Rabbit IgG AA 250-330, C-Term Connectez-vous pour afficher Polyclonal 0
1 ABIN272262 IF IHC (p) WB Rabbit Connectez-vous pour afficher Polyclonal 0
1 ABIN5591065 IF IHC WB Rabbit Connectez-vous pour afficher Polyclonal 0
1 ABIN2892188 IF IHC WB Rabbit Gly311 Connectez-vous pour afficher Polyclonal 0
1 ABIN5957871 ELISA IF IHC (p) WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN2391055 IF IHC ELISA WB Rabbit IgG C-Term Connectez-vous pour afficher Polyclonal 0

General

Antigène Y Box Binding Protein 2 (YBX2) Anticorps
Reactivité Humain
(74), (25), (14), (4), (4), (3), (2), (2), (1)
Hôte Lapin
(73), (1)
Clonalité
Polyclonal
Conjugué Cet anticorp YBX2 est non-conjugé
(4), (4), (4), (4), (4), (4)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(72), (50), (38), (16), (12), (5), (4), (4), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-YBX2 anticorps

Détail du antigène YBX2 Information d'application Stockage Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against a recombinant protein corresponding to amino acids: PPFFYRRRFVRGPRPPNQQQPIEGTDRVEPKETAPLEGHQQQGDERVPPPRFRPRYRRPFRPRPRQQPTTEGGDGETKPSQGPADG
Isotype IgG
Plasmids, Primers & others

Détail du antigène YBX2

Détail du produit anti-YBX2 anticorps Information d'application Stockage Images Haut de la page
Antigène
Autre désignation MSY2 (YBX2 Antibody Extrait)
Sujet Gene Symbol: YBX2
ID gène 51087
UniProt Q9Y2T7
Pathways Chromatin Binding

Information d'application

Détail du produit anti-YBX2 anticorps Détail du antigène YBX2 Stockage Images Haut de la page
Indications d'application Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit anti-YBX2 anticorps Détail du antigène YBX2 Information d'application Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Détail du produit anti-YBX2 anticorps Détail du antigène YBX2 Information d'application Stockage Haut de la page
Images (Fournisseur)
Immunohistochemistry (IHC) image for anti-Y Box Binding Protein 2 (YBX2) antibody (ABIN4335907) Immunohistochemistry: MSY2 Antibody [NBP2-33698] - Immunohistochemical staining of hu...
Immunohistochemistry (IHC) image for anti-Y Box Binding Protein 2 (YBX2) antibody (ABIN4335907) Immunohistochemistry: MSY2 Antibody [NBP2-33698] - pancreas
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Y Box Binding Protein 2 (YBX2) antibody (ABIN4335907) Immunohistochemistry-Paraffin: MSY2 Antibody [NBP2-33698] - liver cancer
Immunofluorescence (IF) image for anti-Y Box Binding Protein 2 (YBX2) antibody (ABIN4335907) Immunocytochemistry/Immunofluorescence: MSY2 Antibody [NBP2-33698] - Staining of huma...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Y Box Binding Protein 2 (YBX2) antibody (ABIN4335907) Immunohistochemistry-Paraffin: MSY2 Antibody - Staining of human prostate shows low ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Y Box Binding Protein 2 (YBX2) antibody (ABIN4335907) Immunohistochemistry-Paraffin: MSY2 Antibody - Staining in human testis and prostate...