Alkaline Phosphatase, Liver/bone/kidney (ALPL) (AA 28-501) protein (His tag)

Détails pour le produit réf. ABIN3206820
Nom de la protéine
  • ALP
  • iap
  • alpl
  • AP-TNAP
  • APTNAP
  • HOPS
  • TNAP
  • TNSALP
  • Akp-2
  • Akp2
  • PHOA
  • TNS-AP
  • alkaline phosphatase, liver/bone/kidney L homeolog
  • alkaline phosphatase, liver/bone/kidney
  • alkaline phosphatase, intestinal, gene 2
  • alkaline phosphatase, liver/bone/kidney pseudogene
  • alpl.L
  • ALPL
  • alpi.2
  • LOC100031702
  • Alpl
Attributs du protein
AA 28-501
3
2
2
1
1
1
1
1
Origine
Humain
9
7
1
Source
Escherichia coli (E. coli)
5
4
2
2
2
2
Type de proteíne
Recombinant
Purification/Conjugué
Cette ALPL protéine est marqué à la His tag.
Application
SDS-PAGE (SDS), ELISA, Western Blotting (WB)
Options
Séquence YWRDQAQETLKYALELQKLNTNVAKNVIMFLGDGMGVSTVTAARILKGQLHHNPGEETRLEMDKFPFVALSKTYNT NAQVPDSAGTATAYLCGVKANEGTVGVSAATERSRCNTTQGNEVTSILRWAKDAGKSVGIVTTTRVNHATPSAAYAHSADRD WYSDNEMPPEALSQGCKDIAYQLMHNIRDIDVIMGGGRKYMYPKNKTDVEYESDEKARGTRLDGLDLVDTWKSFKPRYKHSHF IWNRTELLTLDPHNVDYLLGLFEPGDMQYELNRNNVTDPSLSEMVVVAIQILRKNPKGFFLLVEGGRIDHGHHEGKAKQALHEAV EMDRAIGQAGSLTSSEDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMLSDTDKKPFTAILYGNGPGYKVVGGERENVSMVDYAH NNYQAQSAVPLRHETHGGEDVAVFSKGPMAHLLHGVHEQNYVPHVMAYAACIGANLGHCAPAS
Pureté > 90 % pure
Nom de la protéine
Poids moléculaire 56.2KD
Restrictions For Research Use only
Format Liquid
Buffer Liquid supplied in 6M guanidine hydrochloride and 20mM Tris buffer.
Avez-vous cherché autre chose?