ENO2/NSE Protein (AA 2-285) (His tag)
-
- Antigène Voir toutes ENO2/NSE (ENO2) Protéines
- ENO2/NSE (ENO2) (Enolase 2 (Gamma, Neuronal) (ENO2))
- Type de proteíne
- Recombinant
- Attributs du protein
- AA 2-285
-
Origine
- Humain
-
Source
- Escherichia coli (E. coli)
- Purification/Conjugué
- Cette ENO2/NSE protéine est marqué à la His tag.
- Application
- Western Blotting (WB), SDS-PAGE (SDS), Positive Control (PC), Immunogen (Imm)
- Séquence
- Ser2-Leu285+TILWSPLRTH LTRMIGLPGP SSQPCRDPDC GVMT
- Attributs du produit
- Recombinant Enolase, Neuron Specific (NSE), Prokaryotic expression, Ser2-Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT, N-terminal His Tag
- Pureté
- > 97 %
- Top Product
- Discover our top product ENO2 Protéine
-
-
- Indications d'application
- Optimal working dilution should be determined by the investigator.
- Commentaires
-
Isoelectric Point:5.1
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Buffer
- PBS, pH 7.4, containing 0.01 % SKL, 1 mM DTT, 5 % Trehalose and Proclin300.
- Agent conservateur
- ProClin
- Précaution d'utilisation
- This product contains ProClin: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- 4 °C,-80 °C
- Stockage commentaire
- Store at 2-8°C for one month. Aliquot and store at -80°C for 12 months.
- Date de péremption
- 12 months
-
- Antigène
- ENO2/NSE (ENO2) (Enolase 2 (Gamma, Neuronal) (ENO2))
- Autre désignation
- Enolase, Neuron Specific (ENO2 Produits)
- Synonymes
- ENO2 Protein, DKFZp459B1817 Protein, NSE Protein, AI837106 Protein, D6Ertd375e Protein, Eno-2 Protein, RNEN3 Protein, eno3 Protein, wu:fc09h05 Protein, zgc:92418 Protein, enolase 2 Protein, enolase 2 (gamma, neuronal) Protein, enolase 2, gamma neuronal Protein, enolase 2, gamma, neuronal Protein, ENO2 Protein, Eno2 Protein, eno2 Protein
- Sujet
- ENO2, Enolase 2, Gamma Enolase, 2-phospho-D-glycerate hydro-lyase, Neural enolase
- UniProt
- P09104
-