Pour une meilleure utilisation, nous vous conseillons d’activer Javascript dans votre navigateur.

OGT anticorps

Name: OGT anticorps
Brand: antibodies-online
SKU: ABIN630619
Availability: InStock

Cet anticorps Lapin Polyclonal détecte spécifiquement OGT dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

OGT antibody used at 1 ug/ml to detect target protein. (OGT anticorps)

1 image

N° du produit ABIN630619

1.218,13 €

Plus frais de livraison 40,00 € et TVA

100 μL

Destination: France

Envoi sous 13 à 17 jours ouvrables

Aperçu rapide pour OGT anticorps (ABIN630619)

Antigène

Voir toutes OGT Anticorps

OGT (O-Linked N-Acetylglucosamine (GlcNAc) Transferase (UDP-N-Acetylglucosamine:polypeptide-N-Acetylglucosaminyl Transferase) (OGT))

Reactivité

Humain, Souris, Rat

Hôte

Lapin

Clonalité

Polyclonal

Conjugué

Cet anticorp OGT est non-conjugé

Application

Western Blotting (WB)

Discover our top product OGT Anticorps primaire

Purification

Affinity purified

Immunogène

OGT antibody was raised using a synthetic peptide corresponding to a region with amino acids ASSVGNVADSTEPTKRMLSFQGLAELAHREYQAGDFEAAERHCMQLWRQE
anti-O-Linked N-Acetylglucosamine (GlcNAc) Transferase (UDP-N-Acetylglucosamine:polypeptide-N-Acetylglucosaminyl Transferase) (OGT) (Internal Region) antibody
Verified OGT Reactivité: Humain, Rat WB, ELISA, IHC, IF, FACS Hôte: Chèvre Polyclonal unconjugated

anti-O-Linked N-Acetylglucosamine (GlcNAc) Transferase (UDP-N-Acetylglucosamine:polypeptide-N-Acetylglucosaminyl Transferase) (OGT) antibody
OGT Reactivité: Humain WB, IF, ICC, FACS, IHC (p), IP Hôte: Lapin Polyclonal unconjugated

anti-O-Linked N-Acetylglucosamine (GlcNAc) Transferase (UDP-N-Acetylglucosamine:polypeptide-N-Acetylglucosaminyl Transferase) (OGT) (AA 857-1036) antibody
OGT Reactivité: Humain WB, IHC, IF Hôte: Lapin Polyclonal unconjugated

anti-O-Linked N-Acetylglucosamine (GlcNAc) Transferase (UDP-N-Acetylglucosamine:polypeptide-N-Acetylglucosaminyl Transferase) (OGT) (N-Term) antibody
OGT Reactivité: Humain WB, IF, ICC, IHC (p), IHC (wm) Hôte: Lapin Polyclonal unconjugated

anti-O-Linked N-Acetylglucosamine (GlcNAc) Transferase (UDP-N-Acetylglucosamine:polypeptide-N-Acetylglucosaminyl Transferase) (OGT) antibody
KD Validated OGT Reactivité: Humain WB, FACS Hôte: Lapin Monoclonal 25GB2185 unconjugated Recombinant Antibody

anti-O-Linked N-Acetylglucosamine (GlcNAc) Transferase (UDP-N-Acetylglucosamine:polypeptide-N-Acetylglucosaminyl Transferase) (OGT) (N-Term) antibody
OGT Reactivité: Humain, Souris, Rat, Chien, Boeuf (Vache), Cheval, Lapin, Cobaye, Poisson zèbre (Danio rerio) WB, IHC Hôte: Lapin Polyclonal unconjugated

anti-O-Linked N-Acetylglucosamine (GlcNAc) Transferase (UDP-N-Acetylglucosamine:polypeptide-N-Acetylglucosaminyl Transferase) (OGT) (N-Term) antibody
OGT Reactivité: Humain, Souris WB, ChIP-seq, ChIP Hôte: Lapin Polyclonal unconjugated

anti-O-Linked N-Acetylglucosamine (GlcNAc) Transferase (UDP-N-Acetylglucosamine:polypeptide-N-Acetylglucosaminyl Transferase) (OGT) (AA 1017-1046), (C-Term) antibody
OGT Reactivité: Humain, Souris WB, IHC (p) Hôte: Lapin Polyclonal RB18524 unconjugated

anti-O-Linked N-Acetylglucosamine (GlcNAc) Transferase (UDP-N-Acetylglucosamine:polypeptide-N-Acetylglucosaminyl Transferase) (OGT) (AA 606-1022) antibody
OGT Reactivité: Humain ELISA, IHC, IF Hôte: Lapin Polyclonal unconjugated

anti-O-Linked N-Acetylglucosamine (GlcNAc) Transferase (UDP-N-Acetylglucosamine:polypeptide-N-Acetylglucosaminyl Transferase) (OGT) antibody
OGT Reactivité: Humain WB, ELISA, IHC Hôte: Lapin Monoclonal 8G7 unconjugated Recombinant Antibody

Indications d'application

WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires

OGT Blocking Peptide, (ABIN936919), is also available for use as a blocking control in assays to test for specificity of this OGT antibody

Restrictions

For Research Use only
Format

Lyophilized

Reconstitution

Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OGT antibody in PBS

Concentration

Lot specific

Buffer

PBS

Conseil sur la manipulation

Avoid repeated freeze/thaw cycles.

Stock

4 °C/-20 °C

Stockage commentaire

Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Antigène

OGT (O-Linked N-Acetylglucosamine (GlcNAc) Transferase (UDP-N-Acetylglucosamine:polypeptide-N-Acetylglucosaminyl Transferase) (OGT))

Autre désignation

OGT

Sujet

OGT catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar serine or threonine residues, the two processes may compete for sites, or they may alter the substrate specificity of nearby sites by steric or electrostatic effects. The protein contains nine tetratricopeptide repeats and a putative bipartite nuclear localization signal. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Poids moléculaire

117 kDa (MW of target protein)

Pathways

Regulation of Carbohydrate Metabolic Process