Parathyroid Hormone 2 (PTH2) anticorps

N° du produit ABIN109737

Détail du produit

Antigène: Parathyroid Hormone 2 (PTH2)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: ELISA, Radioimmunoassay (RIA)

Specificité: Human, bovine, canis TIP 39

Immunogène: synthetic human TIP 39 (aa 62-100) KLH conjugated (SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP)

Information d'application

Indications d'application: ELISA (1/4.000) RIA (1/ 2.000) This antibody has not been tested for use in all applications. This does not necessarily exclude its use for non-tested procedures. The stated dilutions are recommendations only. We suggest that the applicant titrates the antibody in his/her system using appropriate negative/positive controls.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Resuspend in aqua bidest.

Stock: 4 °C

Détail du antigène

Antigène: Parathyroid Hormone 2 (PTH2)

Autre désignation: TIP 39 (PTH2 Produits)

Synonymes: anticorps TIP39, anticorps Tifp39, anticorps Tip39, anticorps RGD1559447, anticorps pth2, anticorps parathyroid hormone 2, anticorps parathyroid hormone 1b, anticorps tuberoinfundibular 39 residue protein, anticorps PTH2, anticorps Pth2, anticorps pth1b, anticorps TIP39

Sujet: Serum

Pathways: Sensory Perception of Sound, cAMP Metabolic Process, Regulation of Muscle Cell Differentiation, Tube Formation, Skeletal Muscle Fiber Development