Synthetic human Thymosin 6153815 (aa 1-45) KLH conjugated (MGDRPDLSEVERFDKSKLKKTITEVKNTLPSKETIEQEKEFVKRS)
Indications d'application
ELISA (1/80.000) This antibody has not been tested for use in all applications. This does not necessarily exclude its use for non-tested procedures. The stated dilutions are recommendations only. We suggest that the applicant titrates the antibody in his/her system using appropriate negative/positive controls.