HOXC4 anticorps (N-Term)

N° du produit ABIN1107596

Détail du produit anti-HOXC4 anticorps

Antigène: HOXC4 (Homeobox C4 (HOXC4))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Poisson zèbre (Danio rerio), Chien, Boeuf (Vache)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HOXC4 est non-conjugé

Application: Western Blotting (WB)

Séquence: MIMSSYLMDSNYIDPKFPPCEEYSQNSYIPEHSPEYYGRTRESGFQHHHQ

Réactivité croisée (Details): Species reactivity (expected):Mouse, Rat, Dog, Zebrafish, BovineSpecies reactivity (tested):Human

Purification: Purified on Protein A affinity column.

Immunogène: The immunogen for anti-HOXC4 antibody: synthetic peptide directed towards the N terminal of human HOXC4.

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Restrictions: For Research Use only

Stockage

Reconstitution: Add 100 μL of distilled water

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: -20 °C

Stockage commentaire: Store the lyophised antibody at -20 °C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20 °C long term.

Date de péremption: 12 months

Détails sur HOXC4

Antigène: HOXC4 (Homeobox C4 (HOXC4))

Autre désignation: HOXC4 / HOX3E (HOXC4 Produits)

Synonymes: anticorps HOXC4, anticorps Hox3r3, anticorps hoxc4, anticorps z-96, anticorps zgc:110513, anticorps HOX3, anticorps HOX3E, anticorps cp19, anticorps Hox-3.5, anticorps homeobox C4, anticorps homeo box C4, anticorps homeobox C4a, anticorps hoxc4, anticorps HOXC4, anticorps Hoxc4, anticorps hoxc4a

Sujet: HOXC4 belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, are co-transcribed in a primary transcript. Subsequent processing results in gene-specific transcripts, which sometimes share a 5' non-coding exon.Synonyms: CP19, Homeobox protein Hox-C4, Hox-3E

ID gène: 3221

NCBI Accession: NP_705897