TLR4 anticorps (AA 161-192)

N° du produit ABIN1819425

Cet anticorps anti-TLR4 est un anticorps Chèvre Polyclonal détectant TLR4 dans WB, IHC et IHC (p). Adapté pour Humain et Souris.

Aperçu rapide pour TLR4 anticorps (AA 161-192) (ABIN1819425)

Antigène: TLR4 (Toll-Like Receptor 4 (TLR4))

Reactivité: Humain, Souris

Hôte: Chèvre

Clonalité: Polyclonal

Conjugué: Cet anticorp TLR4 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-TLR4 anticorps

Épitope: AA 161-192

Specificité: Recognizes the human Toll-like receptor 4, also known as CD284, hToll or TLR4. CD284 is an 839 amino acid ~96 kD single pass type I transmembrane glycoprotein expressed by peripheral blood leucocytes, activated T cells, monocytes, macrophages, dendritic cells, granulocytes and endothelial cells. CD284 plays a primary role in the activation of innate immunity. Recognizes an epitope within the N-terminal (NT) region of CD284, a highly conserved member of the toll-like receptor family which acts as a receptor for bacterial lipopolysaccharides (LPS) in co-operation with CD14 and MD2 (LY96), resulting in the activation of the MyD88-dependent and MyD88-independent (TRIF-dependent) signalling pathways and the production of inflammatory cytokines. LPS-activated CD284 can also induce dendritic cell maturation via TRIF-dependent signaling. Is reported to be suitable for use in immunocytochemistry on acetone fixed cells.

Purification: Affinity purified

Immunogène: Synthetic peptide LIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC corresponding to amino acids 161-192 within the N-terminal region of Human CD284. Percent identity by BLAST analysis: Human, Chimpanzee, Orangutan, Gibbon (100%), Gorilla, Baboon, Monkey (97%), Hamster (87%), Sheep, Goat, Dolphin, Zebu, Bovine, Guinea pig (84%), Panda, Cat, Pig (81%).

Type of Immunogen: Synthetic peptide

Isotype: IgG

Information d'application

Indications d'application: Approved: IHC, IHC-P (1:100 - 1:300), WB (1:1000)

Commentaires:

Target Species of Antibody: Human

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: Lot specific

Buffer: PBS, 0.1 % sodium azide, 0.1 % BSA

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C,-20 °C

Stockage commentaire: 4°C or -20°C, Avoid freeze-thaw cycles.

Détails sur TLR4

Antigène: TLR4 (Toll-Like Receptor 4 (TLR4))

Autre désignation: TLR4

Sujet: Name/Gene ID: TLR4
Family: Toll-like Receptor

Synonyms: TLR4, CD284, CD284 antigen, Homolog of Drosophila toll, TLR-4, TOLL, ARMD10, Toll-like receptor 4, HToll

ID gène: 7099

UniProt: O00206

Pathways: Signalisation TLR, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Toll-Like Receptors Cascades, Inflammasome, S100 Proteins