HIV-1 Transmembrane Glycoprotein (HIV-1 gp41) (AA 502-541) anticorps

N° du produit ABIN1819561

Détail du produit

Antigène: HIV-1 Transmembrane Glycoprotein (HIV-1 gp41)

Épitope: AA 502-541

Reactivité: Human Immunodeficiency Virus (HIV), Humain, Virus

Hôte: Chèvre

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB), ELISA

Specificité: Recognizes gp41 from human immunodeficiency virus 1. After cleavage of gp160 into gp120 and gp41, gp41 remains non-covalently bound to gp120 and aids the virus in entering the cell.

Purification: Purified

Immunogène: Synthetic peptide RVVQREKRAVGIVGAMFLGFLGAAGSTMGAVSLTLTVQAR.

Type of Immunogen: Synthetic peptide

Isotype: IgG

Information d'application

Indications d'application: Approved: ELISA (1:50 - 1:500), WB (1:50 - 1:500)

Commentaires:

Target Species of Antibody: Human Immunodeficiency Virus

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: Lot specific

Buffer: 150 mM sodium chloride Ph 6.0-7.0, 0.09 % sodium azide

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: 4°C or -20°C, Avoid freeze-thaw cycles.

Détail du antigène

Antigène: HIV-1 Transmembrane Glycoprotein (HIV-1 gp41)

Autre désignation: HIV-1 Gp41

Classe de substances: Viral Protein