Ataxin 1 anticorps (AA 164-197) (Atto 594)
-
- Antigène Voir toutes Ataxin 1 (ATXN1) Anticorps
- Ataxin 1 (ATXN1)
-
Épitope
- AA 164-197
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Souris
-
Clonalité
- Monoclonal
-
Conjugué
- Cet anticorp Ataxin 1 est conjugé à/à la Atto 594
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP)
- Specificité
- Detects a 85 kD protein.
- Purification
- Protein G purified from tissue culture supernatant
- Immunogène
-
Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1 (Accession No. P54254). Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). Percent identity by BLAST analysis: Mouse, Rat (100%).
Type of Immunogen: Synthetic peptide - Clone
- S76-8
- Isotype
- IgG2b
- Top Product
- Discover our top product ATXN1 Anticorps primaire
-
-
- Indications d'application
-
Approved: IHC, IP, WB
Usage: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested. - Commentaires
-
Target Species of Antibody: Human
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Concentration
- Lot specific
- Buffer
- PBS, pH 7.4, 0.1 % sodium azide, 50 % glycerol.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- -20 °C
- Stockage commentaire
- Store at -20°C.
-
- Antigène
- Ataxin 1 (ATXN1)
- Autre désignation
- ATXN1 / Ataxin-1 / SCA1 (ATXN1 Produits)
- Synonymes
- anticorps ATX1, anticorps D6S504E, anticorps SCA1, anticorps ATXN1, anticorps ataxin 1b, anticorps atxn1, anticorps 2900016G23Rik, anticorps Atx1, anticorps C85907, anticorps ENSMUSG00000074917, anticorps Gm10786, anticorps Sca1, anticorps CG4547, anticorps Dmel\\CG4547, anticorps dAtx-1, anticorps dAtx1, anticorps sca1, anticorps ataxin 1, anticorps ataxin 1b, anticorps Ataxin 1, anticorps ATXN1, anticorps atxn1b, anticorps Atxn1, anticorps Atx-1
- Sujet
-
Name/Gene ID: ATXN1
Synonyms: ATXN1, ATX1, Ataxin 1, D6S504E, Ataxin-1, SCA1 - ID gène
- 6310
- Pathways
- Synaptic Membrane
-