SLC22A2 anticorps (AA 524-555)

N° du produit ABIN2744389

Détail du produit anti-SLC22A2 anticorps

Antigène: SLC22A2 (Solute Carrier Family 22 (Organic Cation Transporter), Member 2 (SLC22A2))

Épitope: AA 524-555

Reactivité: Humain, Rat, Souris, Singe, Orang-Utan

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC22A2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Specificité: Mainly expressed in kidney. Localized at the luminal membrane and basolateral membrane of kidney distal tubule and proximal tubules. To a lower extent, expressed in neurons of the cerebral cortex and in various subcortical nuclei (at protein levels). Also detected in secretory phase endometrium, in scattered cells in the stroma. .

Purification: Immunogen affinity purified

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human SLC22A2 (524-555aa ETIEEAENMQRPRKNKEKMIYLQVQKLDIPLN), different from the related mouse sequence by five amino acids, and from the related rat sequence by seven amino acids.

Isotype: IgG

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

Target Species of Antibody: Human

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: avoid freeze thaw cycles

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Détails sur SLC22A2

Antigène: SLC22A2 (Solute Carrier Family 22 (Organic Cation Transporter), Member 2 (SLC22A2))

Autre désignation: SLC22A2 (SLC22A2 Produits)

Synonymes: anticorps OCT2, anticorps Oct2, anticorps Orct2, anticorps OCT2r, anticorps rOCT2, anticorps Pou2f2, anticorps OCT2P, anticorps oct1, anticorps wu:fc01b11, anticorps zgc:64076, anticorps slc22a2, anticorps solute carrier family 22 member 2, anticorps solute carrier family 22 (organic cation transporter), member 2, anticorps POU class 2 homeobox 2, anticorps solute carrier family 22 (organic cation transporter), member 2 L homeolog, anticorps SLC22A2, anticorps Slc22a2, anticorps POU2F2, anticorps LOC521027, anticorps slc22a2, anticorps slc22a2.L

Sujet: Name/Gene ID: SLC22A2
Subfamily: Organic cation transporter
Family: Transporter

Synonyms: SLC22A2, HOCT2, OCT2, Organic cation transporter 2

ID gène: 6582