TNF alpha anticorps (AA 201-233)

N° du produit ABIN3029349

Cet anticorps anti-TNF alpha Polyclonal Lapin (ABIN3029349) détecte spécifiquement TNF alpha dans WB, FACS et IHC (p). L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour TNF alpha anticorps (AA 201-233) (ABIN3029349)

Antigène: TNF alpha (Tumor Necrosis Factor alpha (TNF alpha))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TNF alpha est non-conjugé

Application: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-TNF alpha anticorps

Épitope: AA 201-233

Fonction: TNF alpha Antibody

Séquence: QLEKGDRLSA EINRPDYLDF AESGQVYFGI IAL

Purification: Antigen affinity

Immunogène: Amino acids 201-233 (QLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL) were used as the immunogen for this TNF alpha antibody.

Isotype: IgG

Information d'application

Indications d'application: The stated application concentrations are suggested starting points. Titration of the TNF alpha antibody may be required due to differences in protocols and secondary/substrate sensitivity.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the TNF alpha antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur TNF alpha

Antigène: TNF alpha (Tumor Necrosis Factor alpha (TNF alpha))

Autre désignation: TNF alpha

Sujet: Tumor Necrosis Factor alpha is a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It binds and functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation and has been implicated in a variety of diseases, including autoimmune diseases, insulin resistance, and cancer. Knockout studies in mice also suggested the neuroprotective function of this cytokine.

UniProt: P01375

Pathways: Signalisation NF-kappaB, Apoptose, Caspase Cascade in Apoptosis, Signalisation TLR, Cellular Response to Molecule of Bacterial Origin, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Positive Regulation of Endopeptidase Activity, Hepatitis C, Protein targeting to Nucleus, Inflammasome