OTX2 anticorps (C-Term)

N° du produit ABIN3032102

Détail du produit anti-OTX2 anticorps

Antigène: OTX2 (Orthodenticle Homeobox 2 (OTX2))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OTX2 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogène: An amino acid sequence from the C-terminus of human Orthodenticle homeobox 2 (DYKDQTASWKLNFNADCLDYKDQTSSWKFQVL) was used as the immunogen for this Otx2 antibody (100% mouse homology).

Isotype: IgG

Information d'application

Indications d'application: The stated application concentrations are suggested starting amounts. Titration of the Otx2 antibody may be required due to differences in protocols and secondary/substrate sensitivity.\. Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the Otx2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur OTX2

Antigène: OTX2 (Orthodenticle Homeobox 2 (OTX2))

Autre désignation: Otx2 (OTX2 Produits)

Synonymes: anticorps CPHD6, anticorps MCOPS5, anticorps E130306E05Rik, anticorps id:ibd2915, anticorps zOtx2, anticorps zgc:136535, anticorps zotx-2, anticorps Xotx-2, anticorps Xotx2, anticorps otx-2, anticorps otx2, anticorps orthodenticle homeobox 2, anticorps orthodenticle homeobox 2 S homeolog, anticorps orthodenticle homeobox 2 L homeolog, anticorps OTX2, anticorps Otx2, anticorps otx2, anticorps otx2.S, anticorps otx2.L

Sujet: Orthodenticle homeobox 2 is also known as CPHD6 or MCOPS5. The OTX2 gene encodes a member of the bicoid subfamily of homeodomain-containing transcription factors. Otx2 acts as a transcription factor and plays a role in brain, craniofacial, and sensory organ development. The encoded protein also influences the proliferation and differentiation of dopaminergic neuronal progenitor cells during mitosis. Mutations in this gene cause syndromic microphthalmia 5 (MCOPS5) and combined pituitary hormone deficiency 6 (CPHD6). Otx2 is also suspected of having an oncogenic role in medulloblastoma. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Pseudogenes of this gene are known to exist on chromosomes two and nine.

ID gène: 5015

Pathways: Dopaminergic Neurogenesis