Involucrin anticorps (C-Term)

N° du produit ABIN3042470

Détail du produit anti-Involucrin anticorps

Antigène: Involucrin (IVL)

Épitope: AA 551-585, C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Involucrin est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Involucrin(IVL) detection. Tested with WB in Human.

Séquence: QVQDIQPALP TKGEVLLPVE HQQQKQEVQW PPKHK

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Involucrin(IVL) detection. Tested with WB in Human.
Gene Name: involucrin
Protein Name: Involucrin

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human Involucrin (551-585aa QVQDIQPALPTKGEVLLPVEHQQQKQEVQWPPKHK).

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur Involucrin

Antigène: Involucrin (IVL)

Autre désignation: IVL (IVL Produits)

Synonymes: anticorps INV, anticorps NPH2, anticorps NPHP2, anticorps 1110019C06Rik, anticorps IVL, anticorps Nphp2, anticorps inv, anticorps involucrin, anticorps inversin, anticorps IVL, anticorps INVS, anticorps Ivl, anticorps Invs

Sujet: Involucrin is a protein component of human skin and in humans is encoded by the IVL gene. It is a highly reactive, soluble, transglutaminase substrate protein present in keratinocytes of epidermisand other stratified squamous epithelia. It first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase thus helping in the formation of an insoluble envelope beneath theplasma membrane functioning as a glutamyl donor during assembly of the cornified envelope. Additionally, Involucrin is synthesised in the stratum spinosum and cross linked in the stratum granulosum by thetransglutaminase enzyme that makes it highly stable. Thus it provides structural support to the cell, thereby allowing the cell to resist invasion by micro-organisms.

Synonyms: INVO_HUMAN antibody|Involucrin antibody|IVL antibody

ID gène: 3713

UniProt: P07476