MCM8 anticorps (C-Term)
-
- Antigène Voir toutes MCM8 Anticorps
- MCM8 (Minichromosome Maintenance Deficient 8 (MCM8))
-
Épitope
- AA 809-840, C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MCM8 est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for DNA helicase MCM8(MCM8) detection. Tested with WB in Human.
- Séquence
- IQVADFENFI GSLNDQGYLL KKGPKVYQLQ TM
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for DNA helicase MCM8(MCM8) detection. Tested with WB in Human.
Gene Name: minichromosome maintenance 8 homologous recombination repair factor
Protein Name: DNA helicase MCM8 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human MCM8 (809-840aa IQVADFENFIGSLNDQGYLLKKGPKVYQLQTM), different from the related mouse and rat sequences by one amino acid.
- Isotype
- IgG
- Top Product
- Discover our top product MCM8 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- MCM8 (Minichromosome Maintenance Deficient 8 (MCM8))
- Autre désignation
- MCM8 (MCM8 Produits)
- Synonymes
- anticorps C20orf154, anticorps dJ967N21.5, anticorps 5730432L01Rik, anticorps minichromosome maintenance 8 homologous recombination repair factor, anticorps minichromosome maintenance 8 homologous recombination repair factor L homeolog, anticorps MCM8, anticorps Mcm8, anticorps mcm8.L
- Sujet
-
DNA replication licensing factor MCM8 is a protein that in humans is encoded by the MCM8 gene. The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein contains the central domain that is conserved among the MCM proteins. And this protein has been shown to co-immunoprecipitate with MCM4, 6 and 7, which suggests that it may interact with other MCM proteins and play a role in DNA replication. Alternatively spliced transcript variants encoding distinct isoforms have been described.
Synonyms: C20orf154 antibody|dJ967N21.5 antibody|DNA helicase MCM8 antibody|DNA replication licensing factor MCM8 antibody|MCM8 antibody| MCM8_HUMAN antibody|MGC119522 antibody|MGC119523 antibody|MGC12866 antibody|MGC4816 antibody|Minichromosome maintenance 8 antibody| Minichromosome maintenance complex component 8 antibody|REC antibody - ID gène
- 84515
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA
-