KERA anticorps (C-Term)

N° du produit ABIN3043276

Détail du produit anti-KERA anticorps

Antigène: KERA (Keratocan (KERA))

Épitope: AA 77-109, C-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KERA est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Keratocan(KERA) detection. Tested with WB in Human,Mouse.

Séquence: YLQNNLIETI PEKPFENATQ LRWINLNKNK ITN

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Keratocan(KERA) detection. Tested with WB in Human,Mouse.
Gene Name: keratocan
Protein Name: Keratocan

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human Keratocan (77-109aa YLQNNLIETIPEKPFENATQLRWINLNKNKITN), different from the related mouse sequence by two amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur KERA

Antigène: KERA (Keratocan (KERA))

Autre désignation: KERA (KERA Produits)

Synonymes: anticorps KERA, anticorps si:dkeyp-38g8.3, anticorps zgc:136259, anticorps CNA2, anticorps SLRR2B, anticorps keratocan, anticorps KERA, anticorps kera, anticorps Kera

Sujet: Keratocan (KTN), also known as keratan sulfate proteoglycan keratocan, is a protein that in humans is encoded by the KERA gene. It is mapped to 12q22. The protein encoded by this gene is a keratan sulfate proteoglycan that is involved in corneal transparency. Defects in this gene are a cause of autosomal recessive cornea plana 2 (CNA2). Keratan sulfate proteoglycans (KSPGs) are members of the small leucine-rich proteoglycan (SLRP) family. KSPGs, particularly keratocan, lumican and mimecan, are important to the transparency of the cornea.

Synonyms: CNA2 antibody|KERA antibody|KERA_HUMAN antibody|Keratan sulfate proteoglycan keratocan antibody|Keratocan antibody|KTN antibody|SLRR2B antibody

ID gène: 11081

UniProt: O60938

Pathways: Glycosaminoglycan Metabolic Process