TGFBR2 anticorps (N-Term)

N° du produit ABIN3043311

Détail du produit anti-TGFBR2 anticorps

Antigène: TGFBR2 (Transforming Growth Factor, beta Receptor II (70/80kDa) (TGFBR2))

Épitope: AA 96-128, N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TGFBR2 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for TGF-beta receptor type-2(TGFBR2) detection. Tested with WB in Human.

Séquence: TLETVCHDPK LPYHDFILED AASPKCIMKE KKK

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for TGF-beta receptor type-2(TGFBR2) detection. Tested with WB in Human.
Gene Name: transforming growth factor, beta receptor II (70/80 kDa)
Protein Name: TGF-beta receptor type-2

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human TGFBR2 (96-128aa TLETVCHDPKLPYHDFILEDAASPKCIMKEKKK), different from the related mouse sequence by five amino acids, and from the related rat sequence by eight amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-TGFBR2 (ABIN3043311)

Sha, Zhao, Tong, Gregersen, Zhao: "Mechanism Investigation of the Improvement of Chang Run Tong on the Colonic Remodeling in Streptozotocin-Induced Diabetic Rats." dans: Journal of diabetes research, Vol. 2016, pp. 1826281, (2016) (PubMed).

Xu, Xu, Saud, Lu, Liu, Fang, Zhang, Hu, Li: "Effect of Kuijie Granule on the Expression of TGF-β/Smads Signaling Pathway in Patients with Ulcerative Colitis." dans: Evidence-based complementary and alternative medicine : eCAM, Vol. 2016, pp. 2601830, (2016) (PubMed).

Détails sur TGFBR2

Antigène: TGFBR2 (Transforming Growth Factor, beta Receptor II (70/80kDa) (TGFBR2))

Autre désignation: TGFBR2 (TGFBR2 Produits)

Synonymes: anticorps AAT3, anticorps FAA3, anticorps LDS1B, anticorps LDS2B, anticorps MFS2, anticorps RIIC, anticorps TAAD2, anticorps TGFR-2, anticorps TGFbeta-RII, anticorps 1110020H15Rik, anticorps AU042018, anticorps DNIIR, anticorps RIIDN, anticorps TBR-II, anticorps TbetaR-II, anticorps TbetaRII, anticorps TGFBR2, anticorps TBETA-RII, anticorps TGFBRII, anticorps TGF-beta 2, anticorps Tgfbr2T, anticorps cb537, anticorps tgfbr2, anticorps wu:fj05c10, anticorps zgc:110498, anticorps transforming growth factor beta receptor 2, anticorps transforming growth factor, beta receptor II, anticorps transforming growth factor, beta receptor 2, anticorps transforming growth factor beta receptor 2b, anticorps TGFBR2, anticorps Tgfbr2, anticorps tgfbr2b

Sujet: TGFBR2 (transforming growth factor, beta receptor II (70/80 kDa)), also known as TGF-beta receptor type-2, TGFR-2, TGF-beta type II receptor, Transforming growth factor-beta receptor type II( TGF-beta receptor type II, TbetaR-II), is a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. A TGFBR2 cDNA encodes a deduced 565-amino acid protein with a calculated molecular mass of approximately 60 kD in length. The encoded protein is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in this gene have been associated with Marfan syndrome, Loeys-Deitz aortic aneurysm syndrome, Osler-Weber-Rendu syndrome, and the development of various types of tumors. Alternatively spliced transcript variants encoding different informs have been characterized.

Synonyms: AAT 3 antibody|AAT3 antibody|FAA 3 antibody|FAA3 antibody|HNPCC6 antibody|LDS1B antibody|LDS2B antibody|MFS 2 antibody|MFS2 antibody| RIIC antibody|TAAD 2 antibody|TAAD2 antibody|TbetaR II antibody|TbetaR-II antibody|TGF beta receptor type 2 antibody|TGF beta receptor type II antibody|TGF beta receptor type IIB antibody|TGF beta type II receptor antibody|TGF-beta receptor type II antibody|TGF-beta receptor type-2 antibody|TGF-beta type II receptor antibody|TGFB R2 antibody|TGFbeta RII antibody|TGFBR 2 antibody|TGFBR2 antibody| TGFR 2 antibody|TGFR-2 antibody|TGFR2 antibody|TGFR2_HUMAN antibody|Transforming growth factor beta receptor II antibody|Transforming growth factor beta receptor type II antibody|Transforming growth factor beta receptor type IIC antibody|Transforming growth factor-beta receptor type II antibody

ID gène: 7048

UniProt: P37173