Neuroserpin anticorps (C-Term)

N° du produit ABIN3043332

Détail du produit anti-Neuroserpin anticorps

Antigène: Neuroserpin (SERPINI1) (serpin Peptidase Inhibitor, Clade I (neuroserpin), Member 1 (SERPINI1))

Épitope: AA 272-310, C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Neuroserpin est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Neuroserpin(SERPINI1) detection. Tested with WB in Human,Mouse,Rat.

Séquence: KAQLVEEWAN SVKKQKVEVY LPRFTVEQEI DLKDVLKA

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Neuroserpin(SERPINI1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: serpin peptidase inhibitor, clade I (neuroserpin), member 1
Protein Name: Neuroserpin

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human Neuroserpin (272-310aa KAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKA L), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur Neuroserpin

Antigène: Neuroserpin (SERPINI1) (serpin Peptidase Inhibitor, Clade I (neuroserpin), Member 1 (SERPINI1))

Autre désignation: SERPINI1 (SERPINI1 Produits)

Synonymes: anticorps PI12, anticorps neuroserpin, anticorps AI837402, anticorps Ns, anticorps PI-12, anticorps Spi17, anticorps CG9453, anticorps Dmel\\CG9453, anticorps Serp2, anticorps Sp4, anticorps Spn4, anticorps Spn4A, anticorps dSerp2, anticorps sp4, anticorps spn4, anticorps raPIT5a, anticorps SERPINI1, anticorps pi12, anticorps serpini1l, anticorps si:ch211-167c22.4, anticorps serpin family I member 1, anticorps serine (or cysteine) peptidase inhibitor, clade I, member 1, anticorps Serpin 42Da, anticorps serpin peptidase inhibitor, clade I (neuroserpin), member 1, anticorps serpin family I member 1 L homeolog, anticorps SERPINI1, anticorps Serpini1, anticorps Spn42Da, anticorps serpini1, anticorps serpini1.L

Sujet: Neuroserpin is a protein that in humans is encoded by the SERPINI1 gene. This gene encodes a member of the serpin superfamily of serine proteinase inhibitors. The protein is primarily secreted by axons in the brain, and preferentially reacts with and inhibits tissue-type plasminogen activator. It is thought to play a role in the regulation of axonal growth and the development of synaptic plasticity. Mutations in this gene result in familial encephalopathy with neuroserpin inclusion bodies (FENIB), which is a dominantly inherited form of familial encephalopathy and epilepsy characterized by the accumulation of mutant neuroserpin polymers. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Synonyms: DKFZp781N13156 antibody|Neuroserpin antibody|NEUS_HUMAN antibody|Peptidase inhibitor 12 antibody|PI-12 antibody|PI12 antibody|Protease inhibitor 12 antibody|Serine or cysteine proteinase inhibitor clade I (neuroserpin) member 1 antibody|Serine or cysteine proteinase inhibitor clade I member 1 antibody|Serpin I1 antibody|Serpin peptidase inhibitor clade I (neuroserpin) member 1 antibody|SERPINI1 antibody

ID gène: 5274

UniProt: Q99574

Pathways: Regulation of Hormone Metabolic Process