Osteopontin anticorps (C-Term)

N° du produit ABIN3043353

Détail du produit anti-Osteopontin anticorps

Antigène: Osteopontin (SPP1) (Secreted phosphoprotein 1 (SPP1))

Épitope: AA 281-314, C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Osteopontin est non-conjugé

Application: Western Blotting (WB), ELISA

Fonction: Rabbit IgG polyclonal antibody for Osteopontin(SPP1) detection. Tested with WB, ELISA in Human,Mouse,Rat.

Séquence: HEDMLVVDPK SKEEDKHLKF RISHELDSAS SEVN

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Osteopontin(SPP1) detection. Tested with WB, ELISA in Human,Mouse,Rat.
Gene Name: secreted phosphoprotein 1
Protein Name: Osteopontin

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human Osteopontin (281-314aa HEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN), different from the related mouse sequence by eight amino acids, and from the related rat sequence by seven amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Human

Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-Osteopontin (ABIN3043353)

Hou, Huang, Luo, Wang, Liu, Deng, Zhang, Liu, Chen: "MiR-351 negatively regulates osteoblast differentiation of MSCs induced by (+)-cholesten-3-one through targeting VDR." dans: American journal of translational research, Vol. 9, Issue 11, pp. 4963-4973, (2017) (PubMed).

Qu, Hui, Wang, Tang, Zhong, Liu, Li, Feng, He et al.: "Reduced Expression of the Extracellular Calcium-Sensing Receptor (CaSR) Is Associated with Activation of the Renin-Angiotensin System (RAS) to Promote Vascular Remodeling in the Pathogenesis of ..." dans: PLoS ONE, Vol. 11, Issue 7, pp. e0157456, (2016) (PubMed).

Yin, Cheng, Qin, Yu, Yu, Zhong, Sun, Zhang: "Effects of Naringin on Proliferation and Osteogenic Differentiation of Human Periodontal Ligament Stem Cells In Vitro and In Vivo." dans: Stem cells international, Vol. 2015, pp. 758706, (2015) (PubMed).

Shan, Zhou, He, Feng, Chen, Zhong: "Expression of both matrix metalloproteinase-2 and its tissue inhibitor-2 in tunica media of radial artery in uremic patients." dans: Renal failure, Vol. 35, Issue 1, pp. 37-42, (2013) (PubMed).

Détails sur Osteopontin

Antigène: Osteopontin (SPP1) (Secreted phosphoprotein 1 (SPP1))

Autre désignation: SPP1 (SPP1 Produits)

Synonymes: anticorps BNSP, anticorps BSPI, anticorps ETA-1, anticorps OPN, anticorps 2AR, anticorps Apl-1, anticorps Bsp, anticorps Eta, anticorps OP, anticorps Opn, anticorps Opnl, anticorps Ric, anticorps Spp-1, anticorps OSP, anticorps zgc:111821, anticorps secreted phosphoprotein 1, anticorps SPP1, anticorps Spp1, anticorps spp1

Sujet: Osteopontin (OPN), also known as secreted phosphoprotein 1 (SPP1), is a protein that in humans is encoded by the SPP1 gene (secreted phosphoprotein 1). The protein encoded by this gene is involved in the attachment of osteoclasts to the mineralized bone matrix. And the encoded protein is secreted and binds hydroxyapatite with high affinity. The osteoclast vitronectin receptor is found in the cell membrane and may be involved in the binding to this protein. Also, this protein is a cytokine that upregulates expression of interferon-gamma and interleukin-12. Several transcript variants encoding different isoforms have been found for this gene.

Synonyms: BNSP antibody|Bone sialoprotein 1 antibody|BSP I antibody|BSPI antibody|Early T lymphocyte activation 1 antibody|ETA 1 antibody|ETA1 antibody|MGC110940 antibody|Nephropontin antibody|OPN antibody|Osteopontin antibody|osteopontin/immunoglobulin alpha 1 heavy chain constant region fusion protein antibody|OSTP_HUMAN antibody|PSEC0156 antibody|secreted phosphoprotein 1 (osteopontin, bone sialoprotein I, early T-lymphocyte activation 1) antibody|Secreted phosphoprotein 1 antibody|SPP 1 antibody|SPP-1 antibody|SPP1 antibody| SPP1/CALPHA1 fusion antibody|Urinary stone protein antibody|Uropontin antibody

ID gène: 6696

UniProt: P10451

Pathways: Regulation of Cell Size