ARID1A anticorps (Middle Region)

N° du produit ABIN3043527

Détail du produit anti-ARID1A anticorps

Antigène: ARID1A (AT Rich Interactive Domain 1A (SWI-Like) (ARID1A))

Épitope: AA 1021-1053, Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ARID1A est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for AT-rich interactive domain-containing protein 1A(ARID1A) detection. Tested with WB in Human.

Séquence: KMWVDRYLAF TEEKAMGMTN LPAVGRKPLD LYR

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for AT-rich interactive domain-containing protein 1A(ARID1A) detection. Tested with WB in Human.
Gene Name: AT rich interactive domain 1A (SWI-like)
Protein Name: AT-rich interactive domain-containing protein 1A

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human ARID1A (1021-1053aa KMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYR), identical to the related mouse sequence.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur ARID1A

Antigène: ARID1A (AT Rich Interactive Domain 1A (SWI-Like) (ARID1A))

Autre désignation: ARID1A (ARID1A Produits)

Synonymes: anticorps B120, anticorps BAF250, anticorps BAF250a, anticorps BM029, anticorps C1orf4, anticorps ELD, anticorps MRD14, anticorps OSA1, anticorps P270, anticorps SMARCF1, anticorps hELD, anticorps hOSA1, anticorps 1110030E03Rik, anticorps Osa1, anticorps Smarcf1, anticorps ARID1A, anticorps wu:fb79b07, anticorps wu:fb95g08, anticorps zgc:171438, anticorps AT-rich interaction domain 1A, anticorps AT rich interactive domain 1A (SWI-like), anticorps AT rich interactive domain 1Aa (SWI-like), anticorps ARID1A, anticorps Arid1a, anticorps arid1a, anticorps arid1aa

Sujet: AT-rich interactive domain-containing protein 1A, also known as p270, is a protein that in humans is encoded by the ARID1A gene. This gene encodes a member of the SWI/SNF families, whose members have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. ARID1A is mapped to 1p36.11. It possesses at least two conserved domains that could be important for its function. First, it has a DNA-binding domain that can specifically bind an AT-rich DNA sequence known to be recognized by a SNF/SWI complex at the beta-globin locus. Second, the C-terminus of the protein can stimulate glucocorticoid receptor-dependent transcriptional activation.

Synonyms: actin-dependent regulator of chromatin subfamily F member 1 antibody|ARI1A_HUMAN antibody| ARID domain containing protein 1A antibody|ARID domain-containing protein 1A antibody| ARID1A antibody|AT rich interactive domain 1A (SWI like) antibody|AT rich interactive domain 1A antibody|AT rich interactive domain containing protein 1A antibody|AT-rich interactive domain-containing protein 1A antibody|B120 antibody|BAF250 antibody|BAF250A antibody|BM029 antibody|brain protein 120 antibody|BRG1 associated factor 250 antibody|BRG1 associated factor 250a antibody|BRG1-associated factor 250 antibody|BRG1-associated factor 250a antibody|C1ORF4 antibody|chromatin remodeling factor p250 antibody|chromosome 1 open reading frame 4 antibody|hELD antibody|hOSA1 antibody|matrix-associated antibody|Osa homolog 1 antibody|OSA1 antibody|OSA1 nuclear protein antibody|P270 antibody|SMARCF1 antibody|SWI like protein antibody|SWI SNF complex protein p270 antibody|SWI-like protein antibody|SWI/SNF complex protein p270 antibody|SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily f, member 1 antibody|SWI/SNF-related antibody

ID gène: 8289

UniProt: O14497

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Tube Formation