JNK2 anticorps (Middle Region)

N° du produit ABIN3043612

Détail du produit anti-JNK2 anticorps

Antigène: JNK2 (MAPK9) (Mitogen-Activated Protein Kinase 9 (MAPK9))

Épitope: AA 257-288, Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp JNK2 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Mitogen-activated protein kinase 9(MAPK9) detection. Tested with WB in Human.

Séquence: RNYVENRPKY PGIKFEELFP DWIFPSESER DK

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Mitogen-activated protein kinase 9(MAPK9) detection. Tested with WB in Human.
Gene Name: mitogen-activated protein kinase 9
Protein Name: Mitogen-activated protein kinase 9

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human JNK2 (257-288aa RNYVENRPKYPGIKFEELFPDWIFPSESERDK), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur JNK2

Antigène: JNK2 (MAPK9) (Mitogen-Activated Protein Kinase 9 (MAPK9))

Autre désignation: MAPK9 (MAPK9 Produits)

Synonymes: anticorps MAPK9, anticorps JNK-55, anticorps JNK2, anticorps JNK2A, anticorps JNK2ALPHA, anticorps JNK2B, anticorps JNK2BETA, anticorps PRKM9, anticorps SAPK, anticorps SAPK1a, anticorps p54a, anticorps p54aSAPK, anticorps AI851083, anticorps Prkm9, anticorps JNK2-ALPHA1, anticorps MAP kinase 9, anticorps mitogen-activated protein kinase 9, anticorps MAP kinase 9, anticorps MAPK9, anticorps Mapk9, anticorps MPK9

Sujet: JNK2 is also known as MAPK9. The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase targets specific transcription factors, and thus mediates immediate-early gene expression in response to various cell stimuli. It is most closely related to MAPK8, both of which are involved in UV radiation induced apoptosis, thought to be related to the cytochrome c-mediated cell death pathway. Also, this gene and MAPK8 are also known as c-Jun N-terminal kinases. This kinase blocks the ubiquitination of tumor suppressor p53, and thus it increases the stability of p53 in nonstressed cells. Studies of this gene's mouse counterpart suggest a key role in T-cell differentiation. Several alternatively spliced transcript variants encoding distinct isoforms have been reported.

Synonyms: c Jun kinase 2 antibody|C Jun N terminal kinase 2 antibody|c-Jun N-terminal kinase 2 antibody|JNK 55 antibody|JNK-55 antibody|JNK2 alpha antibody|JNK2 antibody|JNK2 beta antibody|JNK2A antibody|JNK2alpha antibody|JNK2B antibody|JNK2BETA antibody|Jun kinase antibody|MAP kinase 9 antibody|MAPK 9 antibody|Mapk9 antibody|Mitogen activated protein kinase 9 antibody|Mitogen-activated protein kinase 9 antibody|MK09_HUMAN antibody|P54a antibody|p54aSAPK antibody|PRKM9 antibody|SAPK alpha antibody|SAPK antibody|SAPK1a antibody|Stress activated protein kinase 1a antibody|Stress-activated protein kinase JNK2 antibody

ID gène: 5601

UniProt: P45984

Pathways: Signalisation MAPK, Signalisation WNT, Signalisation TLR, Fc-epsilon Receptor Signaling Pathway, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Endopeptidase Activity, Hepatitis C, Toll-Like Receptors Cascades, BCR Signaling, S100 Proteins