IGFBP2 anticorps (C-Term)

N° du produit ABIN3043858

Détail du produit anti-IGFBP2 anticorps

Antigène: IGFBP2 (Insulin-Like Growth Factor Binding Protein 2, 36kDa (IGFBP2))

Épitope: AA 228-257, C-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IGFBP2 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 2(IGFBP2) detection. Tested with WB in Human,Rat.

Séquence: QQELDQVLER ISTMRLPDER GPLEHLYSLH

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 2(IGFBP2) detection. Tested with WB in Human,Rat.
Gene Name: insulin-like growth factor binding protein 2, 36 kDa
Protein Name: Insulin-like growth factor-binding protein 2

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human IGFBP2 (228-257aa QQELDQVLERISTMRLPDERGPLEHLYSLH), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur IGFBP2

Antigène: IGFBP2 (Insulin-Like Growth Factor Binding Protein 2, 36kDa (IGFBP2))

Autre désignation: IGFBP2 (IGFBP2 Produits)

Synonymes: anticorps IBP2, anticorps IGF-BP53, anticorps AI255832, anticorps IBP-2, anticorps Igfbp-2, anticorps mIGFBP-2, anticorps IGFBP-2, anticorps ILGFBPA, anticorps pIGFBP-2, anticorps igfbp2, anticorps MGC65741, anticorps MGC76823, anticorps MGC174445, anticorps IGFBP2, anticorps ibp2, anticorps igf-bp53, anticorps igfbp2a, anticorps si:ch211-2k18.3, anticorps insulin like growth factor binding protein 2, anticorps insulin-like growth factor binding protein 2, anticorps insulin-like growth factor binding protein 2a, anticorps insulin-like growth factor binding protein 2b, anticorps IGFBP2, anticorps Igfbp2, anticorps igfbp2a, anticorps igfbp2, anticorps igfbp2b

Sujet: The superfamily of insulin-like growth factor (IGF) binding proteins include the six high-affinity IGF binding proteins (IGFBP) and at least four additional low-affinity binding proteins referred to as IGFBP related proteins (IGFBP-rP). All IGFBP superfamily members are cysteine-rich proteins with conserved cysteine residues, which are clustered in the amino- and carboxy-terminal thirds of the molecule. IGFBPs modulate the biological activities of IGF proteins. Some IGFBPs may also have intrinsic bioactivity that is independent of their ability to bind IGF proteins. Post-translational modifications of IGFBPs, including glycosylation, phosphorylation and proteolysis, have been shown to modify the affinities of the binding proteins to IGF. Human IGFBP-2 cDNA encodes a 328 amino acid (aa) residue precursor protein with a putative 39 aa residue signal peptide that is processed to generate the 289 aa residue mature protein. IGFBP-2 contains an integrin receptor recognition sequence (RGD sequence) but lacks potential N-linked glycosylation sites. During development, IGFBP-2 is expressed in a number of tissues. The highest expression level is found in the central nervous system. In adults, high expression levels are also detected in the central nervous system and in a number of reproductive tissues. IGFBP-2 binds preferentially to IGF II, exhibiting a 2-10 fold higher affinity for IGF II than for IGF I.

Synonyms: BP 2 antibody|BP2 antibody|IBP 2 antibody|IBP-2 antibody|IBP2 antibody|IBP2_HUMAN antibody|IGF binding protein 2 antibody|IGF BP53 antibody|IGF-binding protein 2 antibody|IGFBP 2 antibody|IGFBP-2 antibody|IGFBP2 antibody|IGFBP53 antibody|Insulin like growth factor binding protein 2 36 kDa antibody|Insulin like growth factor binding protein 2 antibody|Insulin like growth factor-binding protein 2 precursor antibody|Insulin-like growth factor-binding protein 2 antibody

ID gène: 3485

UniProt: P18065

Pathways: Myometrial Relaxation and Contraction, Growth Factor Binding, Activated T Cell Proliferation