LCK anticorps (C-Term)

N° du produit ABIN3043870

Détail du produit anti-LCK anticorps

Antigène: LCK (Lymphocyte-Specific Protein tyrosine Kinase (LCK))

Épitope: AA 468-506, C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LCK est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Tyrosine-protein kinase Lck(LCK) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: ELYQLMRLCW KERPEDRPTF DYLRSVLEDF FTATEGQYQ

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Tyrosine-protein kinase Lck(LCK) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: LCK proto-oncogene, Src family tyrosine kinase
Protein Name: Tyrosine-protein kinase Lck

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human Lck (468-506aa ELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQ), different from the related mouse and rat sequences by three amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur LCK

Antigène: LCK (Lymphocyte-Specific Protein tyrosine Kinase (LCK))

Autre désignation: LCK (LCK Produits)

Synonymes: anticorps zgc:136695, anticorps LCK, anticorps Hck-3, anticorps Lsk, anticorps Lskt, anticorps p56, anticorps p56Lck, anticorps LSK, anticorps YT16, anticorps p56lck, anticorps pp58lck, anticorps P56LCK, anticorps tkl, anticorps Lck1, anticorps Lcktkr, anticorps LCK proto-oncogene, Src family tyrosine kinase, anticorps lymphocyte protein tyrosine kinase, anticorps lck, anticorps LCK, anticorps Lck

Sujet: Lck (or lymphocyte-specific protein tyrosine kinase) is a 56 kDa protein that is found inside specializedcells of the immune system called lymphocytes. The human LCK gene is mapped to chromosome 1p35-p32. This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein is a key signaling molecule in the selection and maturation of developing T-cells. It contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to the plasma membrane and pericentrosomal vesicles, and binds to cell surface receptors, including CD4 and CD8, and other signaling molecules. Multiple alternatively spliced variants, encoding the same protein, have been described.

Synonyms: IMD22 antibody|LCK antibody|Lck p56 antibody|LCK proto-oncogene, Src family tyrosine kinase antibody|LCK_HUMAN antibody|Leukocyte C-terminal Src kinase antibody|LSK antibody|Lymphocyte cell specific protein tyrosine kinase antibody|Lymphocyte cell-specific protein-tyrosine kinase antibody|Lymphocyte specific protein tyrosine kinase antibody|Membrane associated protein tyrosine kinase antibody| Oncogene lck antibody|P56 LCK antibody|p56(LSTRA) protein tyrosine kinase antibody|p56-LCK antibody|p56lck antibody|pp58 lck antibody| pp58lck antibody|Protein YT16 antibody|Proto oncogene tyrosine protein kinase LCK antibody|Proto-oncogene Lck antibody|Protooncogene tyrosine protein kinase LCK antibody|T cell specific protein tyrosine kinase antibody|T cell-specific protein-tyrosine kinase antibody|T lymphocyte specific protein tyrosine kinase p56lck antibody|Tyrosine-protein kinase Lck antibody|YT 16 antibody|YT16 antibody

ID gène: 3932

UniProt: P06239

Pathways: TCR Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Transition Metal Ion Homeostasis, Positive Regulation of Endopeptidase Activity, CXCR4-mediated Signaling Events, Thromboxane A2 Receptor Signaling