Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

PDIA3 anticorps (C-Term)

PDIA3 Reactivité: Humain, Souris, Rat WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN3043898
  • Antigène Voir toutes PDIA3 Anticorps
    PDIA3 (Protein Disulfide Isomerase Family A, Member 3 (PDIA3))
    Épitope
    • 16
    • 15
    • 9
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 471-505, C-Term
    Reactivité
    • 83
    • 37
    • 34
    • 8
    • 8
    • 7
    • 6
    • 6
    • 6
    • 6
    • 5
    • 4
    • 4
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    Humain, Souris, Rat
    Hôte
    • 68
    • 27
    • 3
    Lapin
    Clonalité
    • 65
    • 33
    Polyclonal
    Conjugué
    • 40
    • 7
    • 7
    • 5
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Cet anticorp PDIA3 est non-conjugé
    Application
    • 75
    • 31
    • 28
    • 27
    • 16
    • 16
    • 15
    • 13
    • 13
    • 8
    • 4
    • 3
    • 2
    • 2
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Fonction
    Rabbit IgG polyclonal antibody for Protein disulfide-isomerase A3(PDIA3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Séquence
    RELSDFISYL QREATNPPVI QEEKPKKKKK AQEDL
    Réactivité croisée (Details)
    No cross reactivity with other proteins.
    Attributs du produit
    Rabbit IgG polyclonal antibody for Protein disulfide-isomerase A3(PDIA3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Gene Name: protein disulfide isomerase family A, member 3
    Protein Name: Protein disulfide-isomerase A3
    Purification
    Immunogen affinity purified.
    Immunogène
    A synthetic peptide corresponding to a sequence at the C-terminus of human ERp57 (471-505aa RELSDFISYLQREATNPPVIQEEKPKKKKKAQEDL), different from the related mouse and rat sequences by two amino acids.
    Isotype
    IgG
    Top Product
    Discover our top product PDIA3 Anticorps primaire
  • Indications d'application
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Commentaires

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Agent conservateur
    Sodium azide
    Précaution d'utilisation
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Conseil sur la manipulation
    Avoid repeated freezing and thawing.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Shen, Chen, Yang, Chen, Liu, Ni: "Redox proteomics identification of specifically carbonylated proteins in the hippocampi of triple transgenic Alzheimer's disease mice at its earliest pathological stage." dans: Journal of proteomics, Vol. 123, pp. 101-13, (2015) (PubMed).

  • Antigène
    PDIA3 (Protein Disulfide Isomerase Family A, Member 3 (PDIA3))
    Autre désignation
    PDIA3 (PDIA3 Produits)
    Synonymes
    anticorps ER60, anticorps ERp57, anticorps ERp60, anticorps ERp61, anticorps GRP57, anticorps GRP58, anticorps HsT17083, anticorps P58, anticorps PI-PLC, anticorps grp-58, anticorps 58kDa, anticorps Erp, anticorps Grp58, anticorps PDI, anticorps PDI-Q2, anticorps PLC[a], anticorps Plca, anticorps 1, anticorps 25D3-membrane-associated, anticorps sb:cb825, anticorps erp57, anticorps grp58, anticorps pdia3, anticorps protein disulfide isomerase family A member 3, anticorps protein disulfide-isomerase A3, anticorps protein disulfide isomerase associated 3, anticorps protein disulfide isomerase family A, member 3, anticorps protein disulfide isomerase family A member 3 S homeolog, anticorps PDIA3, anticorps Tsp_10062, anticorps Pdia3, anticorps pdia3, anticorps pdia3.S
    Sujet
    PDIA3 (Protein disulfide isomerase family A, member 3), also called GRP58, Erp57 or ER60, is an isomerase enzyme. It is mapped on 15q15.3. PDIA3 is also part of the major histocompatibility complex (MHC) class I peptide-loading complex, which is essential for formation of the final antigen conformation and export from the endoplasmic reticulum to the cell surface. This gene encodes a protein of the endoplasmic reticulum that interacts with lectin chaperones calreticulin and calnexin to modulate folding of newly synthesized glycoproteins. The protein was once thought to be a phospholipase, however, it has been demonstrated that the protein actually has protein disulfide isomerase activity. It is thought that complexes of lectins and this protein mediate protein folding by promoting formation of disulfide bonds in their glycoprotein substrates.

    Synonyms: 58 kDa glucose regulated protein antibody|58 kDa glucose-regulated protein antibody|58 kDa microsomal protein antibody|Disulfide isomerase ER 60 antibody|Disulfide isomerase ER-60 antibody|Endoplasmic reticulum resident protein 57 antibody|Endoplasmic reticulum resident protein 60 antibody|ER p57 antibody|ER protein 57 antibody|ER protein 60 antibody|ERp 57 antibody|ERp57 antibody|ERp60 antibody|ERp61 antibody|Glucose Regulated Protein 58 Kd antibody|GRP 57 antibody|GRP 58 antibody|GRP57 antibody|GRP58 antibody| HsT17083 antibody|P58 antibody|PDIA 3 antibody|PDIA3 antibody|PDIA3_HUMAN antibody|Phospholipase C alpha antibody|PI PLC antibody| Protein disulfide isomerase A3 antibody|Protein disulfide isomerase family A member 3 antibody|Protein disulfide-isomerase A3 antibody
    ID gène
    2923
    UniProt
    P30101
    Pathways
    Maintenance of Protein Location, Protein targeting to Nucleus, Cell RedoxHomeostasis
Vous êtes ici:
Support technique