PGRMC1 anticorps (Middle Region)

N° du produit ABIN3043899

Détail du produit anti-PGRMC1 anticorps

Antigène: PGRMC1 (Progesterone Receptor Membrane Component 1 (PGRMC1))

Épitope: AA 67-102, Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PGRMC1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Membrane-associated progesterone receptor component 1(PGRMC1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: RLKRRDFTPA ELRRFDGVQD PRILMAINGK VFDVTK

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Membrane-associated progesterone receptor component 1(PGRMC1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: progesterone receptor membrane component 1
Protein Name: Membrane-associated progesterone receptor component 1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human PGRMC1 (67-102aa RLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTK), identical to the related mouse sequence, and different from the related rat sequence by two amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur PGRMC1

Antigène: PGRMC1 (Progesterone Receptor Membrane Component 1 (PGRMC1))

Autre désignation: PGRMC1 (PGRMC1 Produits)

Synonymes: anticorps MGC89150, anticorps wu:fa94d03, anticorps zgc:103577, anticorps DKFZp469D0815, anticorps HPR6.6, anticorps MPR, anticorps AA415812, anticorps PPMR, anticorps Vema, anticorps 25-Dx, anticorps 25Dx, anticorps VEMA, anticorps progesterone receptor membrane component 1, anticorps pgrmc1, anticorps PGRMC1, anticorps Pgrmc1

Sujet: Progesterone receptor membrane component 1 (PGRMC1) is a protein which co-purifies with progesterone binding proteins in the liver and ovary. In humans, the PGRMC1 protein is encoded by the PGRMC1 gene. The Sigma-2 receptor was recently identified as potentially being the same as PGRMC1. The sole biochemical function of PGRMC1 is heme-binding. PGRMC1 shares key structural motifs with cytochrome b5. It binds and activates P450 proteins, which are important in drug, hormone and lipid metabolism. Also, PGRMC1 binds to PAIR-BP1 (plasminogen activator inhibitor RNA-binding protein-1). However, its expression outside of the reproductive tract and in males suggests multiple functions for the protein. These may include binding to Insig (insulin-induced gene), which regulates cholesterol synthesis.

Synonyms: HPR6.6 antibody|Membrane associated progesterone receptor component 1 antibody|Membrane-associated progesterone receptor component 1 antibody|mPR antibody|PGRC1_HUMAN antibody|PGRMC antibody|Pgrmc1 antibody|Progesterone binding protein antibody|Progesterone receptor membrane component 1 antibody

ID gène: 10857

UniProt: O00264