SULT2A1 anticorps (C-Term)
-
- Antigène Voir toutes SULT2A1 Anticorps
- SULT2A1 (Sulfotransferase Family, Cytosolic, 2A, Dehydroepiandrosterone (DHEA)-Preferring, Member 1 (SULT2A1))
-
Épitope
- AA 253-285, C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SULT2A1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Fonction
- Rabbit IgG polyclonal antibody for Bile salt sulfotransferase(SULT2A1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Séquence
- DWKNHFTVAQ AEDFDKLFQE KMADLPRELF PWE
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Bile salt sulfotransferase(SULT2A1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: sulfotransferase family 2A member 1
Protein Name: Bile salt sulfotransferase - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human SULT2A1 (253-285aa DWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE), different from the related mouse sequence by seven amino acids, and from the related rat sequence by eight amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product SULT2A1 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- SULT2A1 (Sulfotransferase Family, Cytosolic, 2A, Dehydroepiandrosterone (DHEA)-Preferring, Member 1 (SULT2A1))
- Autre désignation
- SULT2A1 (SULT2A1 Produits)
- Synonymes
- anticorps dhea-st, anticorps dheas, anticorps st2, anticorps st2a1, anticorps st2a3, anticorps sta, anticorps std, anticorps SULT2A1, anticorps ST2A1, anticorps Std, anticorps Sth1, anticorps mSTa1, anticorps STa, anticorps Smp-2, anticorps St2, anticorps St2a1, anticorps Sth2, anticorps DHEA-ST, anticorps DHEAS, anticorps HST, anticorps ST2, anticorps ST2A3, anticorps STD, anticorps hSTa, anticorps sulfotransferase family 2A member 1, anticorps sulfotransferase family 2A member 1 L homeolog, anticorps alcohol sulfotransferase, anticorps sulfotransferase family 2A, dehydroepiandrosterone (DHEA)-preferring, member 1, anticorps SULT2A1, anticorps sult2a1.L, anticorps PCC8801_2155, anticorps Cyan8802_2217, anticorps NAL212_1203, anticorps sult2a1, anticorps Sult2a1
- Sujet
-
Bile salt sulfotransferase, also known as hydroxysteroid sulfotransferase (HST) or sulfotransferase 2A1 (ST2A1), is an enzyme that in humans is encoded by the SULT2A1 gene. It is mapped to 19q13.3. This gene encodes a member of the sulfotransferase family. Sulfotransferases aid in the metabolism of drugs and endogenous compounds by converting these substances into more hydrophilic water-soluble sulfate conjugates that can be easily excreted. This protein catalyzes the sulfation of steroids and bile acids in the liver and adrenal glands, and may have a role in the inherited adrenal androgen excess in women with polycystic ovary syndrome.
Synonyms: Alcohol/hydroxysteroid sulfotransferase antibody|Bile salt sulfotranasferase 2A1 antibody|Bile salt sulfotransferase antibody| Dehydroepiandrosterone sulfotransferase antibody|DHEA ST antibody|DHEA sulfotranasferase antibody|DHEA-ST antibody|DHEAS antibody|EC 2.8.2.14 antibody|Hst antibody|hSTa antibody|Hydroxysteroid sulfotransferase antibody|ST2 antibody|ST2A1 antibody|ST2A1_HUMAN antibody|ST2A3 antibody|STD antibody|sulfotranasferase, dehydroepiandrosterone-preferring antibody|Sulfotransferase 2A1 antibody| Sulfotransferase family 2A, dehydroepiandrosterone-preferring, member 1 antibody|Sulfotransferase family cytosolic 2A dehydroepiandrosterone (DHEA) preferring member 1 antibody|Sult2a1 antibody - ID gène
- 6822
- UniProt
- Q06520
- Pathways
- Steroid Hormone Biosynthesis, Regulation of Lipid Metabolism by PPARalpha, Monocarboxylic Acid Catabolic Process
-