TH anticorps (Middle Region)

N° du produit ABIN3043947

Détail du produit anti-TH anticorps

Antigène: TH

Épitope: AA 193-222, Middle Region

Reactivité: Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TH est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Tyrosine 3-monooxygenase(TH) detection. Tested with WB, IHC-P in Mouse,Rat.

Séquence: KVPWFPRKVS ELDKCHHLVT KFDPDLDLDH

Réactivité croisée (Details): Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.

Attributs du produit: Rabbit IgG polyclonal antibody for Tyrosine 3-monooxygenase(TH) detection. Tested with WB, IHC-P in Mouse,Rat.
Gene Name: tyrosine hydroxylase
Protein Name: Tyrosine 3-monooxygenase

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human Tyrosine Hydroxylase (193-222aa KVPWFPRKVSELDKCHHLVTKFDPDLDLDH), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human , The detection limit for Tyrosine Hydroxylase is approximately 0.1 ng/lane under reducing conditions.
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Predicted Species: Species predicted to be fit for the product based on sequence similarities. Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-TH (ABIN3043947)

Hu, Wang, Ren, Liu: "Autonomic remodeling may be responsible for decreased incidence of aortic dissection in STZ-induced diabetic rats via down-regulation of matrix metalloprotease 2." dans: BMC cardiovascular disorders, Vol. 16, Issue 1, pp. 200, (2017) (PubMed).

Su, Fu, Zhang, Shi, Zhang, Gao: "Identification and expression of SRF targeted by miR-133a during early development of Paralichthys olivaceus." dans: Fish physiology and biochemistry, Vol. 41, Issue 5, pp. 1093-104, (2015) (PubMed).

Deng, Jiao, Mi, Xu, Li, Wang, Liu, Xu: "Melatonin inhibits manganese-induced motor dysfunction and neuronal loss in mice: involvement of oxidative stress and dopaminergic neurodegeneration." dans: Molecular neurobiology, Vol. 51, Issue 1, pp. 68-88, (2015) (PubMed).

Li, Jiang, Jiang, Yang, Ma, Yang: "Effect of Guizhi Decoction ([symbols; see text]) on heart rate variability and regulation of cardiac autonomic nervous imbalance in diabetes mellitus rats." dans: Chinese journal of integrative medicine, Vol. 20, Issue 7, pp. 524-33, (2014) (PubMed).

Zhao, Cheng, Fan, Yang, Ye, Cui, Wei, Lao, Cai, Han, Rong et al.: "Botanical drug puerarin coordinates with nerve growth factor in the regulation of neuronal survival and neuritogenesis via activating ERK1/2 and PI3K/Akt signaling pathways in the neurite extension ..." dans: CNS neuroscience & therapeutics, Vol. 21, Issue 1, pp. 61-70, (2014) (PubMed).

Huang, Zhu, Zhang, Zhu, Liu, Zhu, Wang, Li, Yang, Dong, Liu, Chen, Zhang, Yang, Deng, Fan, Wang, Liu, Ma, Fu, Wu: "S100+ cells: a new neuro-immune cross-talkers in lymph organs." dans: Scientific reports, Vol. 3, pp. 1114, (2013) (PubMed).

Hu, Ye, Wang, Zhang, Chen, Guo: "Bone morphogenetic proteins induce rabbit bone marrow-derived mesenchyme stem cells to differentiate into osteoblasts via BMP signals pathway." dans: Artificial cells, nanomedicine, and biotechnology, Vol. 41, Issue 4, pp. 249-54, (2013) (PubMed).

Wan, Liu, Liu, Cai, Chen: "Effect of adenovirus-mediated brain derived neurotrophic factor in early retinal neuropathy of diabetes in rats." dans: International journal of ophthalmology, Vol. 3, Issue 2, pp. 145-8, (2012) (PubMed).

Wu, Ge, Zeng, Zhang: "Induced multilineage differentiation of chicken embryonic germ cells via embryoid body formation." dans: Stem cells and development, Vol. 19, Issue 2, pp. 195-202, (2010) (PubMed).

Wu, Zhao, Zhu, Peng, Jia, Wu, Zheng, Wu: "A novel function of microRNA let-7d in regulation of galectin-3 expression in attention deficit hyperactivity disorder rat brain." dans: Brain pathology (Zurich, Switzerland), Vol. 20, Issue 6, pp. 1042-54, (2010) (PubMed).

Détails sur TH

Antigène: TH

Abstract: TH Produits

Synonymes: anticorps DYT14, anticorps DYT5b, anticorps TYH, anticorps The, anticorps tyrosine hydroxylase, anticorps TH, anticorps Th

Sujet: TH is equal to tyrosine hydroxylase. The protein encoded by this gene is involved in the conversion of tyrosine to dopamine. It is the rate-limiting enzyme in the synthesis of catecholamines, hence plays a key role in the physiology of adrenergic neurons. Mutations in this gene have been associated with autosomal recessive Segawa syndrome. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. In humans, tyrosine hydroxylase is encoded by the TH gene, and the enzyme is present in the central nervous system (CNS), peripheral sympathetic neurons and the adrenal medulla. Tyrosine hydroxylase, phenylalanine hydroxylase and tryptophan hydroxylase together make up the family of aromatic amino acid hydroxylases (AAAHs).

Synonyms: Dystonia 14 antibody|DYT14 antibody|DYT5b antibody|EC 1.14.16.2 antibody|OTTHUMP00000011225 antibody|OTTHUMP00000011226 antibody|ple antibody|Protein Pale antibody|TH antibody|The antibody|TY3H_HUMAN antibody|TYH antibody|Tyrosine 3 hydroxylase antibody|Tyrosine 3 monooxygenase antibody|Tyrosine 3-hydroxylase antibody|Tyrosine 3-monooxygenase antibody| Tyrosine hydroxylase antibody

ID gène: 7054

UniProt: P07101