UHRF1 anticorps (N-Term)

N° du produit ABIN3044567

Détail du produit anti-UHRF1 anticorps

Antigène: UHRF1 (Ubiquitin-Like, Containing PHD and RING Finger Domains, 1 (UHRF1))

Épitope: AA 14-51, N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UHRF1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for E3 ubiquitin-protein ligase UHRF1(UHRF1) detection. Tested with WB, IHC-P in Human.

Séquence: HTVDSLSRLT KVEELRRKIQ ELFHVEPGLQ RLFYRGKQ

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for E3 ubiquitin-protein ligase UHRF1(UHRF1) detection. Tested with WB, IHC-P in Human.
Gene Name: ubiquitin-like with PHD and ring finger domains 1
Protein Name: E3 ubiquitin-protein ligase UHRF1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human UHRF1 (14-51aa HTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQ), different from the related mouse sequence by six amino acids, and from the related rat sequence by five amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur UHRF1

Antigène: UHRF1 (Ubiquitin-Like, Containing PHD and RING Finger Domains, 1 (UHRF1))

Autre désignation: UHRF1 (UHRF1 Produits)

Synonymes: anticorps ICBP90, anticorps Np95, anticorps RNF106, anticorps hNP95, anticorps hUHRF1, anticorps AL022808, anticorps NP95, anticorps fb97f09, anticorps wu:fb97f09, anticorps zgc:63539, anticorps UHRF1, anticorps ubiquitin like with PHD and ring finger domains 1, anticorps ubiquitin-like, containing PHD and RING finger domains, 1, anticorps ubiquitin-like with PHD and ring finger domains 1, anticorps UHRF1, anticorps Uhrf1, anticorps uhrf1

Sujet: Ubiquitin-like, containing PHD and RING finger domains, 1 is a protein which in humans is encoded by the UHRF1 gene. This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle. It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, and functions in the p53-dependent DNA damage checkpoint. It is regarded as a hub protein for the integration of epigenetic information. This gene is up-regulated in various cancers, and it is therefore considered to be a therapeutic target. Multiple transcript variants encoding different isoforms have been found for this gene. A related pseudogene exists on chromosome 12.

Synonyms: Ac2-121 antibody|AL022808 antibody|E3 ubiquitin-protein ligase UHRF1 antibody|EC 6.3.2.- antibody|FLJ21925 antibody|hNP95 antibody| hUHRF1 antibody|HuNp95 antibody|ICBP90 antibody|Inverted CCAAT box binding protein of 90 kDa antibody|Inverted CCAAT box binding protein, 90-kD antibody|Inverted CCAAT box-binding protein of 90 kDa antibody|Liver regeneration-related protein LRRG126 antibody| MGC138707 antibody|NP95 antibody|Nuclear phosphoprotein, 95-KD antibody|Nuclear protein 95 antibody|Nuclear zinc finger protein Np95 antibody|RING finger protein 106 antibody|RNF106 antibody|Transcription factor ICBP90 antibody|Ubiquitin like containing PHD and RING finger domains protein 1 antibody|Ubiquitin like PHD and RING finger domain containing protein 1 antibody|Ubiquitin-like PHD and RING finger domain-containing protein 1 antibody|Ubiquitin-like protein containing PHD and RING finger domains 1 antibody|Ubiquitin-like with PHD and ring finger domains 1 antibody|Ubiquitin-like, containing PHD and RING finger domains, 1 antibody|Ubiquitin-like-containing PHD and RING finger domains protein 1 antibody|UHRF1 antibody|UHRF1_HUMAN antibody

ID gène: 29128

UniProt: Q96T88