Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

ZBTB7A anticorps (N-Term)

ZBTB7A Reactivité: Humain WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN3044568
  • Antigène Voir toutes ZBTB7A Anticorps
    ZBTB7A (Zinc Finger and BTB Domain Containing 7A (ZBTB7A))
    Épitope
    • 15
    • 12
    • 8
    • 6
    • 6
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 125-163, N-Term
    Reactivité
    • 57
    • 22
    • 17
    • 10
    • 7
    • 6
    • 6
    • 4
    • 2
    • 2
    • 1
    Humain
    Hôte
    • 57
    • 2
    Lapin
    Clonalité
    • 56
    • 3
    Polyclonal
    Conjugué
    • 28
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Cet anticorp ZBTB7A est non-conjugé
    Application
    • 50
    • 20
    • 18
    • 14
    • 14
    • 11
    • 5
    • 4
    • 4
    • 1
    • 1
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Fonction
    Rabbit IgG polyclonal antibody for Zinc finger and BTB domain-containing protein 7A(ZBTB7A) detection. Tested with WB, IHC-P in Human.
    Séquence
    DLLDRQILAA DAGADAGQLD LVDQIDQRNL LRAKEYLEF
    Réactivité croisée (Details)
    No cross reactivity with other proteins.
    Attributs du produit
    Rabbit IgG polyclonal antibody for Zinc finger and BTB domain-containing protein 7A(ZBTB7A) detection. Tested with WB, IHC-P in Human.
    Gene Name: zinc finger and BTB domain containing 7A
    Protein Name: Zinc finger and BTB domain-containing protein 7A
    Purification
    Immunogen affinity purified.
    Immunogène
    A synthetic peptide corresponding to a sequence at the N-terminus of human ZBTB7A (125-163aa DLLDRQILAADAGADAGQLDLVDQIDQRNLLRAKEYLEF), different from the related mouse sequence by eleven amino acids, and from the related rat sequence by ten amino acids.
    Isotype
    IgG
    Top Product
    Discover our top product ZBTB7A Anticorps primaire
  • Indications d'application
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Commentaires

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Agent conservateur
    Sodium azide
    Précaution d'utilisation
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Conseil sur la manipulation
    Avoid repeated freezing and thawing.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Antigène
    ZBTB7A (Zinc Finger and BTB Domain Containing 7A (ZBTB7A))
    Autre désignation
    ZBTB7A (ZBTB7A Produits)
    Synonymes
    anticorps ZBTB7A, anticorps FBI-1, anticorps FBI1, anticorps LRF, anticorps ZBTB7, anticorps ZNF857A, anticorps pokemon, anticorps 9030619K07Rik, anticorps 9130006G12Rik, anticorps AI452336, anticorps Lrf, anticorps Pokemon, anticorps Zbtb7, anticorps OCZF, anticorps zinc finger and BTB domain containing 7A, anticorps zinc finger and BTB domain containing 7C, anticorps zinc finger and BTB domain containing 7a, anticorps ZBTB7A, anticorps ZBTB7C, anticorps Zbtb7a
    Sujet
    Zinc finger and BTB domain-containing protein 7A is a protein that in humans is encoded by the ZBTB7A gene. ZBTB7A has a critical oncosuppressive role in the prostate. Prostate-specific inactivation of ZBTB7A leads to a marked acceleration of PTEN loss-driven prostate tumorigenesis through bypass of PTEN loss-induced cellular senescence. It has been showed that ZBTB7A physically interacts with SOX9 and functionally antagonizes its transcriptional activity on key target genes such as MIA, which is involved in tumor cell invasion, and H19, a long noncoding RNA precursor for an RB-targeting microRNA. Inactivation of ZBTB7A in vivo leads to RB downregulation, bypass of PTEN loss-induced cellular senescence, and invasive prostate cancer. Notably, it has been also found that ZBTB7A is genetically lost, as well as downregulated at both the mRNA and protein levels, in a subset of human advanced prostate cancers. Therefore, ZBTB7A is identified as a context-dependent cancer gene that can act as an oncogene in some contexts but that also has oncosuppressive-like activity in PTEN-null tumors.

    Synonyms: DKFZp547O146 antibody|Factor binding IST protein 1 antibody|Factor that binds to inducer of short transcripts protein 1 antibody|FBI-1 antibody|FBI1 antibody|HIV-1 1st-binding protein 1 antibody|HIV-1 inducer of short transcripts binding protein antibody|HIV-1 inducer of short transcripts-binding factor 1 antibody|Leukemia/lymphoma-related factor antibody|LRF antibody|lymphoma related factor antibody|MGC99631 antibody|POK erythroid myeloid ontogenic factor antibody|Pokemon antibody|POZ and Krueppel erythroid myeloid ontogenic factor antibody|TIP21 antibody|TTF-I-interacting peptide 21 antibody|ZBT7A_HUMAN antibody|ZBTB7 antibody|ZBTB7A antibody| Zinc finger and BTB domain containing 7A antibody|zinc finger and BTB domain containing 7A, HIV-1 inducer of short transcripts binding protein antibody|Zinc finger and BTB domain-containing protein 7A antibody|Zinc finger protein 857A antibody|Zinc finger- and BTB domain-containing protein 7 antibody|ZNF857A antibody
    ID gène
    51341
    UniProt
    O95365
Vous êtes ici:
Support technique