TLR4 anticorps (AA 161-192)

N° du produit ABIN342783

Cet anticorps anti-TLR4 est un anticorps Chèvre Polyclonal détectant TLR4 dans WB et ICC. Adapté pour Humain.

Aperçu rapide pour TLR4 anticorps (AA 161-192) (ABIN342783)

Antigène: TLR4 (Toll-Like Receptor 4 (TLR4))

Reactivité: Humain

Hôte: Chèvre

Clonalité: Polyclonal

Conjugué: Cet anticorp TLR4 est non-conjugé

Application: Western Blotting (WB), Immunocytochemistry (ICC)

Détail du produit anti-TLR4 anticorps

Épitope: AA 161-192

Specificité: Peptide sequence is <50 % identical to other human TLR receptors in this region. The antibody recognizes human TLR4, mouse, and rat TLR4.

Homologie: Percent identity by BLAST analysis: Human, Chimpanzee, Orangutan, Gibbon (100%) Gorilla, Baboon, Monkey (97%) Marmoset (94%) Hamster (87%) Sheep, Goat, Zebu, Bovine (84%) Rat, Dolphin, Panda, Bat, Cat, Pig (81%).

Purification: Immunoaffinity purified

Immunogène: Synthetic peptide LIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC corresponding to aa 161-192 of the N-terminal domain of Human TLR4. Percent identity by BLAST analysis: Human, Chimpanzee, Orangutan, Gibbon (100%), Gorilla, Baboon, Monkey (97%), Marmoset (94%), Hamster (87%), Sheep, Goat, Zebu, Bovine (84%), Rat, Dolphin, Panda, Bat, Cat, Pig (81%).

Type of Immunogen: Synthetic peptide

Information d'application

Indications d'application: Approved: ICC (1:200), WB

Commentaires:

Target Species of Antibody: Human

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: Lot specific

Buffer: Phosphate buffered saline, 1 mg/mL BSA, 0.1 % sodium azide

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Aliquot to Avoid freeze/thaw cycles.

Stock: -20 °C

Stockage commentaire: Store at -20°C. Aliquot to avoid freeze/thaw cycles.

Détails sur TLR4

Antigène: TLR4 (Toll-Like Receptor 4 (TLR4))

Autre désignation: TLR4

Sujet: Name/Gene ID: TLR4
Family: Toll-like Receptor

Synonyms: TLR4, CD284, CD284 antigen, Homolog of Drosophila toll, TLR-4, TOLL, ARMD10, Toll-like receptor 4, HToll

ID gène: 7099

UniProt: O00206

Pathways: Signalisation TLR, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Toll-Like Receptors Cascades, Inflammasome, S100 Proteins