ABCB10 anticorps (C-Term)

N° du produit ABIN4886409

Détail du produit anti-ABCB10 anticorps

Antigène: ABCB10 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 10 (ABCB10))

Épitope: AA 640-678, C-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ABCB10 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for ATP-binding cassette sub-family B member 10, mitochondrial(ABCB10) detection. Tested with WB in Human,Rat.

Séquence: QRIAIARALL KNPKILLLDE ATSALDAENE YLVQEALDR

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for ATP-binding cassette sub-family B member 10, mitochondrial(ABCB10) detection. Tested with WB in Human,Rat.
Gene Name: ATP binding cassette subfamily B member 10
Protein Name: ATP-binding cassette sub-family B member 10, mitochondrial

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human ABCB10 (640-678aa QRIAIARALLKNPKILLLDEATSALDAENEYLVQEALDR), different from the related mouse sequence by one amino acid.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur ABCB10

Antigène: ABCB10 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 10 (ABCB10))

Autre désignation: ABCB10 (ABCB10 Produits)

Synonymes: anticorps EST20237, anticorps M-ABC2, anticorps MTABC2, anticorps Abc-me, anticorps Abcb12, anticorps ABCB10, anticorps si:dkey-162b3.3, anticorps GB10581, anticorps ATP binding cassette subfamily B member 10, anticorps ATP-binding cassette, sub-family B (MDR/TAP), member 10, anticorps ATP-binding cassette sub-family B member 10, mitochondrial, anticorps ABCB10, anticorps Abcb10, anticorps abcb10, anticorps LOC552744

Sujet: ABCB10, also known as M-ABC2, is expressed as a 60-kD nonglycosylated mitochondrial membrane protein. This ABCB10 gene is mapped to 1q42.13. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. And ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The function of this mitochondrial protein is unknown.

Synonyms: ABC transporter 10 protein | ABCB10 | EST20237 | M ABC2 | M-ABC2 | MTABC2 | Q9NRK6

ID gène: 23456