AGO4 anticorps (N-Term)

N° du produit ABIN4886439

Détail du produit anti-AGO4 anticorps

Antigène: AGO4 (EIF2C4) (Eukaryotic Translation Initiation Factor 2C, 4 (EIF2C4))

Épitope: AA 114-153, N-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AGO4 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Protein argonaute-4(AGO4) detection. Tested with WB in Human,Rat.

Séquence: KDQTFKVSVQ WVSVVSLQLL LEALAGHLNE VPDDSVQALD

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Protein argonaute-4(AGO4) detection. Tested with WB in Human,Rat.
Gene Name: argonaute 4, RISC catalytic component
Protein Name: Protein argonaute-4

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human Argonaute 4 (114-153aa KDQTFKVSVQWVSVVSLQLLLEALAGHLNEVPDDSVQALD), identical to the related mouse sequence.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur AGO4

Antigène: AGO4 (EIF2C4) (Eukaryotic Translation Initiation Factor 2C, 4 (EIF2C4))

Autre désignation: AGO4 (EIF2C4 Produits)

Synonymes: anticorps EIF2C4, anticorps ago4, anticorps Argonaute4, anticorps argonaute-4, anticorps eif2c4, anticorps wu:fd14f04, anticorps ARGONAUTE 4, anticorps OCP11, anticorps OVEREXPRESSOR OF CATIONIC PEROXIDASE 11, anticorps T20P8.9, anticorps T20P8_9, anticorps Eif2c4, anticorps 5730550L01Rik, anticorps AI481660, anticorps argonaute 4, RISC catalytic component, anticorps argonaute 1, RISC catalytic component, anticorps argonaute RISC catalytic component 4, anticorps Argonaute family protein, anticorps argonaute 4, RISC catalytic component L homeolog, anticorps argonaute RISC catalytic subunit 4, anticorps AGO4, anticorps ago1, anticorps ago4, anticorps Ago4, anticorps ago4.L

Sujet: AGO4 (Argonaute 4) is also known as EIF2C4. This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic containing PAZ and PIWI domains, and it may play a role in short-interfering-RNA-mediated gene silencing. This gene is located on chromosome 1 in a cluster of closely related family members including argonaute 3, and eukaryotic translation initiation factor 2C, 1.

Synonyms: Ago 4 | Ago4 | Argonaute4 |Argonaute 4 | Argonaute-4 | EIF 2C 4 | eIF-2C 4 | eIF2C 4 | eif2c4 | hAgo4 | KIAA1567 | Protein argonaute-4 | Q9HCK5

ID gène: 192670

Pathways: Fc-epsilon Receptor Signaling Pathway, Regulatory RNA Pathways, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Cellular Glucan Metabolic Process