ACCN1 anticorps (N-Term)

N° du produit ABIN4886476

Détail du produit anti-ACCN1 anticorps

Antigène: ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))

Épitope: AA 112-147, N-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACCN1 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Acid-sensing ion channel 2(ASIC2) detection. Tested with WB in Human,Rat.

Séquence: ELLALLDVNL QIPDPHLADP SVLEALRQKA NFKHYK

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Acid-sensing ion channel 2(ASIC2) detection. Tested with WB in Human,Rat.
Gene Name: acid sensing ion channel subunit 2
Protein Name: Acid-sensing ion channel 2

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human ACCN1 (112-147aa ELLALLDVNLQIPDPHLADPSVLEALRQKANFKHYK), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur ACCN1

Antigène: ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))

Autre désignation: ASIC2 (ACCN1 Produits)

Synonymes: anticorps ACCN, anticorps ACCN1, anticorps ASIC2a, anticorps BNC1, anticorps BNaC1, anticorps MDEG, anticorps hBNaC1, anticorps ACIC2, anticorps Accn1, anticorps BNaC1a, anticorps Mdeg, anticorps BNC1k, anticorps MDEG1, anticorps MDEG2, anticorps accn1, anticorps zASIC2, anticorps acid sensing ion channel subunit 2, anticorps acid-sensing (proton-gated) ion channel 2, anticorps ASIC2, anticorps Asic2, anticorps asic2

Sujet: Amiloride-sensitive cation channel 1, neuronal, also known as ASIC2, is a protein that in humans is encoded by the ACCN1 gene. This gene encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, 2 hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. The member encoded by this gene may play a role in neurotransmission. In addition, a heteromeric association between this member and acid-sensing (proton-gated) ion channel 3 has been observed to co-assemble into proton-gated channels sensitive to gadolinium. Alternative splicing has been observed at this locus and two variants, encoding distinct isoforms, have been identified.

Synonyms: Acid sensing ion channel 2 | ACCN | ACCN1 | ASIC2 | ASIC2a | BNaC1 | BNC1 | Brain sodium channel 1 | Degenerin | MDEG | Q16515

ID gène: 40

UniProt: Q16515

Pathways: Sensory Perception of Sound