CCT3 anticorps (C-Term)

N° du produit ABIN4886513

Détail du produit anti-CCT3 anticorps

Antigène: CCT3 (Chaperonin Containing TCP1, Subunit 3 (Gamma) (CCT3))

Épitope: AA 497-536, C-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CCT3 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for T-complex protein 1 subunit gamma(CCT3) detection. Tested with WB in Human,Rat.

Séquence: EPLAVKLQTY KTAVETAVLL LRIDDIVSGH KKKGDDQSRQ

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for T-complex protein 1 subunit gamma(CCT3) detection. Tested with WB in Human,Rat.
Gene Name: chaperonin containing TCP1 subunit 3
Protein Name: T-complex protein 1 subunit gamma

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human CCT3 (497-536aa EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQ), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur CCT3

Antigène: CCT3 (Chaperonin Containing TCP1, Subunit 3 (Gamma) (CCT3))

Autre désignation: CCT3 (CCT3 Produits)

Synonymes: anticorps chunp6930, anticorps wu:fb13f04, anticorps wu:fb52a02, anticorps wu:fj48b06, anticorps NV18778, anticorps CCT-gamma, anticorps CCTG, anticorps PIG48, anticorps TCP-1-gamma, anticorps TRIC5, anticorps AL024092, anticorps Cctg, anticorps Tcp1-rs3, anticorps TriC-P5, anticorps chaperonin containing TCP1, subunit 3 (gamma), anticorps T-complex protein 1 subunit gamma, anticorps chaperonin containing TCP1 subunit 3 L homeolog, anticorps chaperonin containing TCP1 subunit 3, anticorps chaperonin containing Tcp1, subunit 3 (gamma), anticorps cct3, anticorps CC1G_11423, anticorps Cctgamma, anticorps tcpg, anticorps cct3.L, anticorps CCT3, anticorps Cct3

Sujet: T-complex protein 1 subunit gamma is a protein that in humans is encoded by the CCT3 gene. The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants have been characterized for this gene. In addition, a pseudogene of this gene has been found on chromosome 8.

Synonyms: CCT 3 | CCT3 | CCT gamma | CCT-gamma | CCTG | CCT G | hTRiC5 | PIG48 | TCP 1 gamma | TCP-1-gamma | TRIC5 | P49368

ID gène: 7203

UniProt: P49368